PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 166aa    MW: 18904.3 Da    PI: 5.6737
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033843genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.51.5e-40151141100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+Ca+dC+lapyfp ++p++fa++hk+FGasnv+kll+a+pe+ r +a++s+ yeA  r++dPvyG++g+i +l++q++++++e+a ++
  Lus10033843  15 RCAGCKFLRRRCAQDCILAPYFPPTSPQRFAFAHKVFGASNVTKLLQAVPEDLRGNAADSISYEATLRVKDPVYGCAGIIYQLEKQIREVESEMAIVN 112
                  6*********************************************************************************************9988 PP

       DUF260  99 ee 100
                  ++
  Lus10033843 113 SR 114
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.08614115IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3915112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MSSSNSQQQE NPRRRCAGCK FLRRRCAQDC ILAPYFPPTS PQRFAFAHKV FGASNVTKLL  60
QAVPEDLRGN AADSISYEAT LRVKDPVYGC AGIIYQLEKQ IREVESEMAI VNSRLAFYTT  120
QYQQQQQQQQ HIDAAEFDAD DDLMLWPALT VQDIQHNSMD PYFLY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-361611812114LOB family transfactor Ramosa2.1
5ly0_B4e-361611812114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10033843
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316444.36e-45LOB domain-containing protein 24
SwissprotQ9LQR01e-42LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2K1YZY85e-43A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGLus100338431e-121(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-42LOB domain-containing protein 1