PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family VOZ
Protein Properties Length: 431aa    MW: 47633.7 Da    PI: 5.3254
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033657genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ358.33e-1101864021217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pp saf+gpkcalwdctrpaqgse   +yc s+h + a+ +g pg  p++rpkgi +kd+ lf+al+ak+qgkevgip+c gaa+++spwna++lfd+
  Lus10033657 186 PPLSAFMGPKCALWDCTRPAQGSESSMEYCCSLHRDAAVSDGGPGRPPTVRPKGIRMKDNFLFDALTAKIQGKEVGIPQCVGAASTRSPWNAPDLFDI 283
                  788*********************************************************************************************** PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeinelda.lalyrlelklvdekks 195
                  sl+e et+rew+ffd+pr+a++sg+rkqrslpdy+grgwhesrkqv+   g +krsyymdpqpsss+ewhlyey++ ++da +aly+le+kl+++kk+
  Lus10033657 284 SLFEEETLREWVFFDEPRKAYDSGSRKQRSLPDYKGRGWHESRKQVIS-PGCQKRSYYMDPQPSSSHEWHLYEYQVLNSDAsCALYKLEYKLAEAKKT 380
                  **********************************************96.699************************9999659*************** PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  ++gkvsk sladlq k+ rl+a
  Lus10033657 381 PRGKVSKASLADLQMKMNRLNA 402
                  *******************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MQNGQKSKSH HHIKDIAKNW VNDHEGRLSD LRAAVREGRQ RDFEVLAEQV FQSIGELRTE  60
LDAPTPASSS LVEDDATSAP TQFPVMEPPH GTQQINESHS LGDFTAYHDG FLESAGTQNH  120
DFHGLDQTAG GFLDAFDSIE TKPSDLSAYF DSDQYIDFDY GLPVDINPNE GFMKETESSK  180
PSYVSPPLSA FMGPKCALWD CTRPAQGSES SMEYCCSLHR DAAVSDGGPG RPPTVRPKGI  240
RMKDNFLFDA LTAKIQGKEV GIPQCVGAAS TRSPWNAPDL FDISLFEEET LREWVFFDEP  300
RKAYDSGSRK QRSLPDYKGR GWHESRKQVI SPGCQKRSYY MDPQPSSSHE WHLYEYQVLN  360
SDASCALYKL EYKLAEAKKT PRGKVSKASL ADLQMKMNRL NADGTPDSSP SNGSAKSNVK  420
AESSPSGTVP *
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10033657
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002326034.11e-146transcription factor VOZ1
RefseqXP_024447611.11e-146transcription factor VOZ1
TrEMBLB9IQS11e-144B9IQS1_POPTR; VOZ family protein
STRINGLus100336570.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-114vascular plant one zinc finger protein