PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 26466.3 Da    PI: 9.9339
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033187genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.97.3e-30959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fsstgkl+e++s
  Lus10033187  9 KRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEFIS 59
                 79***********************************************86 PP

2K-box87.33.1e-29711701100
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  yq++ g++ +++++e++q +l+kLk+ ++ L++e+R+++Ge+L++L++ +++ L  ++++++k iR++Kn+++++qie+++k+ ++++e++++L + +
  Lus10033187  71 YQRTLGVDIWTTHYEKMQDHLKKLKDVNRDLRKEIRRRMGECLNDLEFDQMRALDMEMDNAVKIIRERKNQVIFNQIERQKKMVRNVEEIHRNLLHAF 168
                  67788899**************************************************************************************9998 PP

        K-box  99 ee 100
                  +e
  Lus10033187 169 QE 170
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.338161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.40E-40280No hitNo description
PRINTSPR004044.8E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-36395IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-293859IPR002100Transcription factor, MADS-box
PfamPF014864.1E-1882168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.7284174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARGKIQIKR IENSTNRQVT YSKRRNGLFK KANELTVLCD AKVSIIMFSS TGKLHEFISP  60
AATTKGMLDQ YQRTLGVDIW TTHYEKMQDH LKKLKDVNRD LRKEIRRRMG ECLNDLEFDQ  120
MRALDMEMDN AVKIIRERKN QVIFNQIERQ KKMVRNVEEI HRNLLHAFQE REEDPHYGLV  180
DNGGGYEPAV VGFPTGGSRV FALRLNHHNL HTATTATGSD LTTFHLLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-15159159MEF2C
5f28_B2e-15159159MEF2C
5f28_C2e-15159159MEF2C
5f28_D2e-15159159MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10033187
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028059352.11e-114floral homeotic protein DEFICIENS isoform X1
SwissprotP237061e-110DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A0P0I7J51e-117A0A0P0I7J5_MERAN; Apetala 3-like protein
STRINGLus100331871e-171(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-88MIKC_MADS family protein
Publications ? help Back to Top
  1. Schwarz-Sommer Z, et al.
    Characterization of the Antirrhinum floral homeotic MADS-box gene deficiens: evidence for DNA binding and autoregulation of its persistent expression throughout flower development.
    EMBO J., 1992. 11(1): p. 251-63
    [PMID:1346760]
  2. Sommer H, et al.
    Deficiens, a homeotic gene involved in the control of flower morphogenesis in Antirrhinum majus: the protein shows homology to transcription factors.
    EMBO J., 1990. 9(3): p. 605-13
    [PMID:1968830]
  3. Gallois JL, et al.
    Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana.
    Gene, 2013. 526(2): p. 299-308
    [PMID:23747397]
  4. Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H
    Multiple interactions amongst floral homeotic MADS box proteins.
    EMBO J., 1996. 15(16): p. 4330-43
    [PMID:8861961]