PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 543aa    MW: 60626.2 Da    PI: 6.2682
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032919genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.1e-5291361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp GfrF+Ptdeelv++yL+ k+++++ ++ +vi+e+d++k+ePwdLp  + vk+++ ew+fF++ d+ky++g+r nrat +gyWkatgkd++++s +
  Lus10032919   9 LPLGFRFRPTDEELVDFYLRLKINNQHEDV-RVIREIDVCKWEPWDLPdlSIVKTKDPEWFFFCPLDRKYPNGSRLNRATVKGYWKATGKDRKIKS-G 104
                  699************************999.99**************96447778889**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++l+g+kktLvfy+grapkg++t+Wvmheyr 
  Lus10032919 105 QNLIGMKKTLVFYTGRAPKGQRTHWVMHEYRT 136
                  99****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-603159IPR003441NAC domain
PROSITE profilePS5100555.6069159IPR003441NAC domain
PfamPF023651.2E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MAVLPLNSLP LGFRFRPTDE ELVDFYLRLK INNQHEDVRV IREIDVCKWE PWDLPDLSIV  60
KTKDPEWFFF CPLDRKYPNG SRLNRATVKG YWKATGKDRK IKSGQNLIGM KKTLVFYTGR  120
APKGQRTHWV MHEYRTTEDD LDGTKPGQSP FVLCRLFKKQ DPTVEDLHSD EGAETTVLSH  180
TTATTTAQSS PDVTQSQTPS DLPLPADSPL DTTSVPAVVE SFQSSPRVQN PAMPNVAPVE  240
RAMQVKEPFN WFYVPPPESL DDKIFSPLHT QVQAELGSSC GYYPINSNPA NKFADENEAE  300
LSEFLDSILD YSYDDQSRPG AEIGQNMVGS IDPVEDRKPT LQVEETPGVA DTNLLLDRKM  360
FENFKYFQAD PCDDGQWNRV GHLTGNQFNN LGEASSNINL VASASSNEIE ASGNIKIRSR  420
DPQKRYAVNF GAQGDAHRRL QLQTKLCAPS CDTNEKPSDG SFLSEEVESR KAHMEGAAGK  480
QMKGSKDLGR KNATAAVSKK FRFIVMKASS TFGRVRSGFT LRAVLLMVFF VTAVSAWRCI  540
SC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-44816016166NO APICAL MERISTEM PROTEIN
1ut4_B2e-44816016166NO APICAL MERISTEM PROTEIN
1ut7_A2e-44816016166NO APICAL MERISTEM PROTEIN
1ut7_B2e-44816016166NO APICAL MERISTEM PROTEIN
4dul_A2e-44816016166NAC domain-containing protein 19
4dul_B2e-44816016166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10032919
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021627352.11e-140NAC domain-containing protein 91-like isoform X1
SwissprotQ9LKG81e-100NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A0M3R8491e-139A0A0M3R849_MANES; NAC transcription factors 3
STRINGLus100329190.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.23e-97TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]