PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 168aa    MW: 18225.8 Da    PI: 7.4234
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031855genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-4461051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l+++p ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  Lus10031855   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQEIPVQHRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAVAQ 103
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Lus10031855 104 AE 105
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3985106IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQEIPVQHRA  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEVLCIQ MQQQDPVSSA  120
SASIFPNPTD LLDHSQHLLA SYGLNFSSSG ATNTVIQDPL KRESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296053.11e-86PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW34e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A068ULU33e-88A0A068ULU3_COFCA; Uncharacterized protein
STRINGVIT_06s0004g07200.t016e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-75LBD family protein