PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 149aa    MW: 16860.4 Da    PI: 10.5461
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031665genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF915.9e-291059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +ien++ rqvtfskRrng+lKKA+ELSvLCdaev v++fs++g+lye+ss
  Lus10031665 10 KIENTTSRQVTFSKRRNGLLKKANELSVLCDAEVGVVVFSQRGRLYEFSS 59
                 69**********************************************96 PP

2K-box50.49.8e-18851451171
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 
                  +  +++l+qe+a L ++ie Lq + R+llGe+Les++l+e++   ++Le+sl+k+R +K +
  Lus10031665  85 SCIQQQLKQESASLANKIELLQASTRRLLGEGLESCTLEEIKDTSDKLERSLTKVRLRKVR 145
                  445799****************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.202161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-29323IPR002100Transcription factor, MADS-box
CDDcd002651.13E-38372No hitNo description
SuperFamilySSF554559.94E-32378IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-1487144IPR002487Transcription factor, K-box
PROSITE profilePS512979.77588148IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MVRGKVEMRK IENTTSRQVT FSKRRNGLLK KANELSVLCD AEVGVVVFSQ RGRLYEFSSH  60
GMDKTIARYR KYATVEINRS DSAASCIQQQ LKQESASLAN KIELLQASTR RLLGEGLESC  120
TLEEIKDTSD KLERSLTKVR LRKVRTTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_R1e-18182182Myocyte-specific enhancer factor 2B
1tqe_S1e-18182182Myocyte-specific enhancer factor 2B
5f28_A1e-18182182MEF2C
5f28_B1e-18182182MEF2C
5f28_C1e-18182182MEF2C
5f28_D1e-18182182MEF2C
6byy_A1e-18182182MEF2 CHIMERA
6byy_B1e-18182182MEF2 CHIMERA
6byy_C1e-18182182MEF2 CHIMERA
6byy_D1e-18182182MEF2 CHIMERA
6bz1_A9e-19183183MEF2 CHIMERA
6bz1_B9e-19183183MEF2 CHIMERA
6bz1_C9e-19183183MEF2 CHIMERA
6bz1_D9e-19183183MEF2 CHIMERA
6c9l_A1e-18182182Myocyte-specific enhancer factor 2B
6c9l_B1e-18182182Myocyte-specific enhancer factor 2B
6c9l_C1e-18182182Myocyte-specific enhancer factor 2B
6c9l_D1e-18182182Myocyte-specific enhancer factor 2B
6c9l_E1e-18182182Myocyte-specific enhancer factor 2B
6c9l_F1e-18182182Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10031665
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018461087.14e-58PREDICTED: MADS-box protein AGL42 isoform X3
RefseqXP_027339462.19e-58MADS-box protein SOC1-like isoform X2
SwissprotQ9FIS17e-57AGL42_ARATH; MADS-box protein AGL42
TrEMBLQ0WRE27e-56Q0WRE2_ARATH; AGAMOUS-like 42
STRINGLus100316651e-103(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.33e-59AGAMOUS-like 42