PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 363aa    MW: 41153.2 Da    PI: 5.6007
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031189genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1591.9e-49331592128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                   pGfrFhPtdeel+++yL++kv++k+l++ e ik+vdiyk++PwdLp+++  ++ke yfF++r +ky+++ r+nr+t sg+Wkatg dk+v+s  +++
  Lus10031189  33 LPGFRFHPTDEELLSFYLRRKVDNKPLSI-ELIKQVDIYKYDPWDLPRSTGDGDKEGYFFCRRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSMaGDN 129
                  59***************************.89***************88889999*************************************996777 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +glkktLv+y+g+a kg+ktdW+mhe+rl
  Lus10031189 130 CIGLKKTLVYYRGSAGKGTKTDWMMHEFRL 159
                  8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.56332199IPR003441NAC domain
SuperFamilySSF1019414.18E-5433199IPR003441NAC domain
PfamPF023651.3E-2434159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNSSTITSDD NCDDHRDREE EEEEEEEDDD ISLPGFRFHP TDEELLSFYL RRKVDNKPLS  60
IELIKQVDIY KYDPWDLPRS TGDGDKEGYF FCRRGRKYRN SIRPNRVTGS GFWKATGIDK  120
PVYSMAGDNC IGLKKTLVYY RGSAGKGTKT DWMMHEFRLP TSDQTGTNNI NSYIASLESS  180
KLISAQEAEV WTICRIFKRN SSNRKYTPDW RELSTSKRPL TNPNSNNYNN NNTSGATRTH  240
QQHFIDFTAP HVQSFDTKPP TSQHHMAGPA QDDDQSIIMS TMMMMDRSSS IITPSRPTTA  300
LHSTNSSSHH SELVAPQSSS SMASSTSNIS SPYGNDQFLT YGDFDELRSV VEFAFDPSNN  360
FL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-483420519171NO APICAL MERISTEM PROTEIN
1ut4_B6e-483420519171NO APICAL MERISTEM PROTEIN
1ut7_A6e-483420519171NO APICAL MERISTEM PROTEIN
1ut7_B6e-483420519171NO APICAL MERISTEM PROTEIN
3swm_A7e-483420522174NAC domain-containing protein 19
3swm_B7e-483420522174NAC domain-containing protein 19
3swm_C7e-483420522174NAC domain-containing protein 19
3swm_D7e-483420522174NAC domain-containing protein 19
3swp_A7e-483420522174NAC domain-containing protein 19
3swp_B7e-483420522174NAC domain-containing protein 19
3swp_C7e-483420522174NAC domain-containing protein 19
3swp_D7e-483420522174NAC domain-containing protein 19
4dul_A6e-483420519171NAC domain-containing protein 19
4dul_B6e-483420519171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00353DAPTransfer from AT3G12910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10031189
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021615211.11e-123transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK553e-85NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A2C9VRP81e-122A0A2C9VRP8_MANES; Uncharacterized protein
STRINGLus100311890.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-84NAC domain containing protein 42
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]