PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GATA
Protein Properties Length: 114aa    MW: 12407.2 Da    PI: 10.7123
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031096genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.4e-183063134
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                 Cs+Cg  kTp+WR gp g ktLCnaCG++y++ +
  Lus10031096 30 CSHCGIQKTPQWRTGPHGAKTLCNACGVRYKSGR 63
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.9E-152474IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.9782460IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.23E-162688No hitNo description
Gene3DG3DSA:3.30.50.107.4E-162861IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.41E-142978No hitNo description
PROSITE patternPS0034403055IPR000679Zinc finger, GATA-type
PfamPF003208.3E-173064IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MKKKQKKKEK PTAAVGNSDE ALPPAQQRKC SHCGIQKTPQ WRTGPHGAKT LCNACGVRYK  60
SGRLFPEYRP AGSPTFSNEM HSNSHRKVLE MRKRKEGEMS AASADPTPAG PGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033458.11e-42PREDICTED: GATA transcription factor 5-like
RefseqXP_008796881.15e-42PREDICTED: GATA transcription factor 5
SwissprotQ9FH574e-41GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A059AGC64e-42A0A059AGC6_EUCGR; Uncharacterized protein
TrEMBLB9H0W86e-42B9H0W8_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16860.12e-41(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-41GATA transcription factor 5