PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 353aa    MW: 40144.4 Da    PI: 6.2367
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030978genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.1e-5161351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                  lppGfrFhPtdeelv +yL++kv+g ++el ev++ vd+yk++Pw+Lp k  +  ++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++++++ 
  Lus10030978   6 LPPGFRFHPTDEELVGYYLHRKVHGLEIEL-EVVPVVDLYKFDPWELPeKsFLPRRDMEWFFFCPRDRKYPNGSRTNRATRAGYWKATGKDRKIVCRs 102
                  79****************************.99**************95334455788*************************************987 PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   g l+g +ktLvfy+grap g + dWvmheyr+
  Lus10030978 103 PGGLTGYRKTLVFYRGRAPLGDRMDWVMHEYRF 135
                  7889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-584156IPR003441NAC domain
PROSITE profilePS5100558.1446156IPR003441NAC domain
PfamPF023652.6E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLHRKVHG LEIELEVVPV VDLYKFDPWE LPEKSFLPRR  60
DMEWFFFCPR DRKYPNGSRT NRATRAGYWK ATGKDRKIVC RSPGGLTGYR KTLVFYRGRA  120
PLGDRMDWVM HEYRFEDDPY SSSTQGAYAL CRIVKRNEQA SKTGSRDASP SSSLMITGDA  180
TARSRRGSRK NGELVASTSV IFSEGLNLSD SLQSTPMSSP PRQVTTESEQ LISVDTNDPS  240
NPWLLSPDLI LDTSKEYSRD QGSGFFSHYK STTTMMIQPW HQHCDNNEPF STSSASYSNF  300
VMADNVEHSS DHDLSHIGSW NMSPYMDLWG NDEQPDMTSF YNDYDHMNNT NH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-50516216171NO APICAL MERISTEM PROTEIN
1ut4_B6e-50516216171NO APICAL MERISTEM PROTEIN
1ut7_A6e-50516216171NO APICAL MERISTEM PROTEIN
1ut7_B6e-50516216171NO APICAL MERISTEM PROTEIN
4dul_A6e-50516216171NAC domain-containing protein 19
4dul_B6e-50516216171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10030978
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519841.11e-116NAC domain-containing protein 71
SwissprotO496975e-90NAC71_ARATH; NAC domain-containing protein 71
TrEMBLB9S1H61e-115B9S1H6_RICCO; Transcription factor, putative
STRINGLus100309780.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67223450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-92NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]