PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 430aa    MW: 48033.7 Da    PI: 8.2284
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030478genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.1e-53181451128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  + pGfrFhPtdeelv +yLk+k+++++l++ e ik+vdiyk++PwdLpk+++++ekewyfF++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ ++
  Lus10030478  18 MLPGFRFHPTDEELVGFYLKRKIHQRPLSI-ELIKHVDIYKYDPWDLPKMTATGEKEWYFFCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGN 114
                  579***************************.89***************8888999***************************************9566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +glkk+Lvfykgra kg ktdW+mhe+rl
  Lus10030478 115 KCIGLKKSLVFYKGRATKGMKTDWMMHEFRL 145
                  67***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-609181IPR003441NAC domain
PROSITE profilePS5100557.51418181IPR003441NAC domain
PfamPF023651.6E-2620145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MEGESSCSTN LNMDQEVMLP GFRFHPTDEE LVGFYLKRKI HQRPLSIELI KHVDIYKYDP  60
WDLPKMTATG EKEWYFFCPR DRKYRNSARP NRVTGAGFWK ATGTDRPIYS SEGNKCIGLK  120
KSLVFYKGRA TKGMKTDWMM HEFRLPSLSD NHRPPAATSN RAADRTIPAN DAWAICRIFK  180
KTSSTVQRAI SQSWVLPNST ISPHDQVLSR ASGNFFHPSH LSPNKISTTT SLAPPIHQPC  240
HFNYNNNNND TYLDQTHQSN NNFCSFNKPN KPDSFQNLHN NYPLNIETNH SFPSSSLSPF  300
YHLNMPSSSP PSMLLGDFEQ LQGRDHESIG STGPYQLSGA SQRSNGGGGL MSTPIQVGGM  360
HDDQTVANTM VKSADLAHVD ALSLDGLGDI TSPTTWKQNL LLWDYLNSAA SPCPSDHVTS  420
AFSMTKCYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531318512169NO APICAL MERISTEM PROTEIN
1ut4_B2e-531318512169NO APICAL MERISTEM PROTEIN
1ut7_A2e-531318512169NO APICAL MERISTEM PROTEIN
1ut7_B2e-531318512169NO APICAL MERISTEM PROTEIN
3swm_A3e-531318515172NAC domain-containing protein 19
3swm_B3e-531318515172NAC domain-containing protein 19
3swm_C3e-531318515172NAC domain-containing protein 19
3swm_D3e-531318515172NAC domain-containing protein 19
3swp_A3e-531318515172NAC domain-containing protein 19
3swp_B3e-531318515172NAC domain-containing protein 19
3swp_C3e-531318515172NAC domain-containing protein 19
3swp_D3e-531318515172NAC domain-containing protein 19
4dul_A2e-531318512169NAC domain-containing protein 19
4dul_B2e-531318512169NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10030478
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023920077.11e-120protein FEZ-like
SwissprotQ9FIW54e-97NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A2R6RFD01e-117A0A2R6RFD0_ACTCH; Protein FEZ like
STRINGLus100304780.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-99NAC domain containing protein 94