PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 276aa    MW: 31590.9 Da    PI: 9.0391
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030446genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.4e-54241491128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL+++++++++++ ++i+evdiyk++Pw+Lp+k+  +ekewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++s +++
  Lus10030446  24 LPPGFRFHPTDEELIMCYLRNQATSRPCPV-SIIPEVDIYKFDPWQLPEKAGFGEKEWYFFSPRDRKYPNGVRPNRATGSGYWKATGTDKSIYS-GSQ 119
                  79****************************.89***************99999*****************************************.99* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfykg+ pkg ktdW+mheyrl
  Lus10030446 120 YVGVKKALVFYKGKPPKGIKTDWIMHEYRL 149
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6717176IPR003441NAC domain
PROSITE profilePS5100560.84524176IPR003441NAC domain
PfamPF023657.3E-2725149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MMMIAGEGTT TRTKNMNMNN DYVLPPGFRF HPTDEELIMC YLRNQATSRP CPVSIIPEVD  60
IYKFDPWQLP EKAGFGEKEW YFFSPRDRKY PNGVRPNRAT GSGYWKATGT DKSIYSGSQY  120
VGVKKALVFY KGKPPKGIKT DWIMHEYRLC DSRTRTVKAS GSMRLDEWVL CRIYKKKPSV  180
SKQYLEQDIN GTEAFKEQQQ QMLKLSKTCS LSDLDSLGPI SQLLDDHSNP NYQTNTGFLV  240
PENTVGSAQN LGQHQVMNDQ QQPFLVNPQM MHQFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-732418217171NO APICAL MERISTEM PROTEIN
1ut4_B9e-732418217171NO APICAL MERISTEM PROTEIN
1ut7_A9e-732418217171NO APICAL MERISTEM PROTEIN
1ut7_B9e-732418217171NO APICAL MERISTEM PROTEIN
3swm_A1e-722418220174NAC domain-containing protein 19
3swm_B1e-722418220174NAC domain-containing protein 19
3swm_C1e-722418220174NAC domain-containing protein 19
3swm_D1e-722418220174NAC domain-containing protein 19
3swp_A1e-722418220174NAC domain-containing protein 19
3swp_B1e-722418220174NAC domain-containing protein 19
3swp_C1e-722418220174NAC domain-containing protein 19
3swp_D1e-722418220174NAC domain-containing protein 19
4dul_A9e-732418217171NAC domain-containing protein 19
4dul_B9e-732418217171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10030446
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021807478.11e-113NAC transcription factor 29-like
SwissprotK4BNG71e-109NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLM0ZSU11e-111M0ZSU1_SOLTU; Uncharacterized protein
TrEMBLM5XSI21e-111M5XSI2_PRUPE; Uncharacterized protein
STRINGLus100304460.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-104NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]