PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 416aa    MW: 45413.8 Da    PI: 8.2268
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030184genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
      Lus10030184 24 RERWTDEEHNRFLEALKLYGRA-WQKIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0031973IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-92175IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002492.1E-132467IPR001005SANT/Myb domain
CDDcd001676.60E-102669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MDAFSSGEDL LIKTRKPYTI TKQRERWTDE EHNRFLEALK LYGRAWQKIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVTKG VPVAQALDID IPPPRPKRKP SNPYPRKTGA SSVTSQAGAK  120
EDGKLSTSLP FPPSKVLDLE KEPLPEKPSG DEKSTGAKEN HDESCSEVFT SSSSIFSLKK  180
NSTLQPGGLR NPCSFREFVP CLKDAVSQDE SRVTTELDGN KKWHKPELTP KVYDNGSSKA  240
PRGNCCHLLK KLHQHKNNAD GDAIMVPEDK IQAMQNCPRH VPVHILDGNV PSNESTVPVE  300
ESHARSDVYS LPTASAAEFP NNMAACSTNQ SFPPFPHPFA PSLHNQDDYR SFVQMSSAFS  360
SLIASSLLQN PAAHAAASFA ASFWPYANVG NPADSSTCTS GGFSSRTKPG QPSSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10030184
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515093.11e-147protein LHY isoform X1
RefseqXP_015572367.11e-147protein LHY isoform X1
TrEMBLB9RMV41e-146B9RMV4_RICCO; Uncharacterized protein
STRINGLus100301840.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.44e-56MYB_related family protein