PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 373aa    MW: 40341.9 Da    PI: 7.7867
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029293genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18186240256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Lee F+++++++ +++ eLAk+l+L  rqV vWFqNrRa+ k
  Lus10029293 186 RKKLRLSKDQSAFLEESFKEHNTLNPKQKLELAKQLNLRPRQVEVWFQNRRARTK 240
                  678899***********************************************98 PP

2HD-ZIP_I/II127.55.7e-41186276192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlsk+q+++LEesF+e+++L+p++K ela++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Lus10029293 186 RKKLRLSKDQSAFLEESFKEHNTLNPKQKLELAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 276
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.52E-18181243IPR009057Homeodomain-like
PROSITE profilePS5007116.989182242IPR001356Homeobox domain
SMARTSM003899.0E-16184246IPR001356Homeobox domain
CDDcd000862.82E-16186243No hitNo description
PfamPF000467.4E-16186240IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-17191240IPR009057Homeodomain-like
PROSITE patternPS000270217240IPR017970Homeobox, conserved site
PfamPF021837.8E-11242276IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.0E-26242285IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELALSLGDA SKSFKFLDKA QPSKLPTNDH HLGFCMAFSG AGVGAAGGTA SSMERSQEII  60
HDARRVINVP STADPQPSLQ LDLSPFSPVP RGPTPATAAP SPLPFPWLVT DPAQRESQSR  120
RFDVNRLSAE EGDDADGASL SSPNSAATSS FRMDFGIGIN SNGKRDLDQE GERAGGSEDD  180
ENGLGRKKLR LSKDQSAFLE ESFKEHNTLN PKQKLELAKQ LNLRPRQVEV WFQNRRARTK  240
LKQTEVDCEY LKRCCETLTE ENRRLQKELQ ELRALKTSQP FYMQHPATTL TMCPSCERVA  300
TTTTTTTSTA ATSSTTAAPA STTTATTNSS STTLSLGNNS CNGKVGKVYP FPSVQLQMSQ  360
QHSSQPTNPA GS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234242RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10029293
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322729.21e-126homeobox-leucine zipper protein HOX11
SwissprotP466653e-89HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9IIA11e-125B9IIA1_POPTR; HD-ZIP family protein
STRINGLus100292930.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-79homeobox from Arabidopsis thaliana