PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 29684.8 Da    PI: 10.2875
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029275genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.94.3e-312675150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien+ nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  Lus10029275 26 KRIENTQNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 75
                 79***********************************************8 PP

2K-box19.24.9e-08162196438
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhl 38 
                  +++ s++ea+a+++qqe+a L+++i nL +++R+l
  Lus10029275 162 TNTGSVAEANAQYYQQEAATLRQKIGNLLNTNRKL 196
                  334449*************************9997 PP

3K-box61.82.7e-212132633484
        K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                  + Rh+ Ge+L+ L  k+L++Le++Lek++++iRskKnell+++ie++qk+ 
  Lus10029275 213 SSRHMPGESLGGLGPKDLKNLESKLEKGISRIRSKKNELLFSEIEYMQKRV 263
                  57***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-411877IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.2071878IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-291978IPR002100Transcription factor, MADS-box
CDDcd002651.49E-361977No hitNo description
PROSITE patternPS0035002074IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-322040IPR002100Transcription factor, MADS-box
PfamPF003191.3E-262774IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-324055IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-325576IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.116172265IPR002487Transcription factor, K-box
PfamPF014861.8E-14213262IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSGYQSDSRG DSPSQRKIGR GKIEIKRIEN TQNRQVTFCK RRNGLLKKAY ELSVLCDAEV  60
ALIVFSSRGR LYEYANNRGC LERQPLLSEA MFLLTSKGGN GRKKDWNGKG NEEESEVQIV  120
VEVKKMKDLS VTCKLVNIRV FISLPSVKDT IERYKKANSD STNTGSVAEA NAQYYQQEAA  180
TLRQKIGNLL NTNRKLAMFV NHNNNDGGGG GSSSRHMPGE SLGGLGPKDL KNLESKLEKG  240
ISRIRSKKNE LLFSEIEYMQ KRVIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-201877160Myocyte-specific enhancer factor 2B
1tqe_Q6e-201877160Myocyte-specific enhancer factor 2B
1tqe_R6e-201877160Myocyte-specific enhancer factor 2B
1tqe_S6e-201877160Myocyte-specific enhancer factor 2B
6c9l_A6e-201877160Myocyte-specific enhancer factor 2B
6c9l_B6e-201877160Myocyte-specific enhancer factor 2B
6c9l_C6e-201877160Myocyte-specific enhancer factor 2B
6c9l_D6e-201877160Myocyte-specific enhancer factor 2B
6c9l_E6e-201877160Myocyte-specific enhancer factor 2B
6c9l_F6e-201877160Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101126RKKDWNGKGNEEESEVQIVVEVKKMK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10029275
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1788373e-52AY178837.1 Momordica charantia mads-box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190130.15e-69K-box region and MADS-box transcription factor family protein
SwissprotQ435853e-39AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLA0A3P6BT978e-68A0A3P6BT97_BRACM; Uncharacterized protein
TrEMBLA0A3P6CSP71e-68A0A3P6CSP7_BRACM; Uncharacterized protein
STRINGLus100292750.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68429102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.32e-51MIKC_MADS family protein
Publications ? help Back to Top
  1. Cheung AY,Zhan XY,Wang H,Wu HM
    Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8
    [PMID:8632979]