PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028899
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 185aa    MW: 21144.9 Da    PI: 9.4717
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028899genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC66.63.4e-21138179142
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                  d+epgrCrRtDGKkWRCs++ l+++k+C++H+hrgr ++++s
  Lus10028899 138 DDEPGRCRRTDGKKWRCSKESLPDHKYCQKHMHRGRLNRNRS 179
                  68*********************************9766665 PP

2QLQ416e-1570104337
          QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  FT +Q+q+L  Q ++yKy+ a++ vP+ Ll++i++
  Lus10028899  70 FTVSQIQELQLQWMIYKYIEAGLRVPQSLLVPIWN 104
                  9*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.0E-568104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.89669104IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-1070103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.599138184IPR014977WRC domain
PfamPF088793.3E-18140179IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MENNHSSYQS ESSSLSQRIP TFNIPRLSSD SPTIGLGLGL MTGSGSKDED DHDHDITNLQ  60
LGNSRLGVVF TVSQIQELQL QWMIYKYIEA GLRVPQSLLV PIWNSLHSAV PLINTPTLSL  120
SWTQWREMSR YKKGVELDDE PGRCRRTDGK KWRCSKESLP DHKYCQKHMH RGRLNRNRSR  180
KPVE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537666.12e-36PREDICTED: growth-regulating factor 4-like
SwissprotQ6ZIK51e-33GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLI1LFW52e-36I1LFW5_SOYBN; Uncharacterized protein
STRINGGLYMA11G01060.16e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.11e-32growth-regulating factor 3