PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 343aa    MW: 37588.1 Da    PI: 7.8861
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028181genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-41176253178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+egC+adl++ak+yhrrhkvCe+hska++vl++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+++
  Lus10028181 176 RCQAEGCTADLTHAKHYHRRHKVCEFHSKASTVLAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSNQ 253
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.2E-35172238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.308174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-38175255IPR004333Transcription factor, SBP-box
PfamPF031101.5E-30177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MLEYEWAAAA NHLISGSDEP NQQESPDQSR QIFDHYSNAA SATEAHHHHS FTDHNSLLPP  60
QPPSAALFHH SFFDPRGATT YAAGYATTTH NPSLLSLDHP SGNPYFLVPK SEDDGGMVMT  120
AAARSSSDFS SRIGLNLGGR TYFSSTEDDF VSRLYRRSRS TLHEHGGGGM MTNAPRCQAE  180
GCTADLTHAK HYHRRHKVCE FHSKASTVLA AGLTQRFCQQ CSRFHLLSEF DNGKRSCRKR  240
LADHNRRRRK SNQNNTNTNQ SQETLKAPAA AAETGWNNNS PSDNLTERSP PSESGIQSCS  300
SVTVAVSPPR MFLDCFKQRP YDQATASSSS SASSSSLFFL SG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311772501184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10028181
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083646.11e-114squamosa promoter-binding-like protein 8
TrEMBLA0A067JXX71e-112A0A067JXX7_JATCU; Uncharacterized protein
STRINGLus100281810.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.16e-62squamosa promoter binding protein-like 8