PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family B3
Protein Properties Length: 370aa    MW: 42012.7 Da    PI: 8.7133
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027940genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.12.8e-128891398
                 TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3 13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                 s++ ++p +f++++ ++   +  ++l+ ++g +W++ +   k ++++++ +GW++Fv++  +++g  + F+++g+  f+ ++  f+
  Lus10027940  8 SCMQRIPDNFIKKFAND--LTHLVRLTVPDGHVWRIGI--VKADDKFWFHDGWNDFVESYSIRVGYLLGFRYEGNAIFNVHMLYFS 89
                 68889*********877..6668***************..*********************************9998877766665 PP

2B358.81e-18250340498
                  E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  vl ps+  + ++++lp +fae++ +g++     ++l+ ++g++W v++    k+gr  l++GW eF  +n++ egD++vF++ ++++  l+v+vfr
  Lus10027940 250 VLRPSYLYRGCIMYLPSSFAEKNlNGVSG---FIKLQFTDGKQWPVRC--LYKGGRAKLSQGWYEFTLENNIGEGDVCVFEMLKSRDVVLKVTVFR 340
                  78899******************876743...49999999********..66666778***********************888888889999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.984189IPR003340B3 DNA binding domain
CDDcd100173.59E-13186No hitNo description
SMARTSM010195.4E-6491IPR003340B3 DNA binding domain
PfamPF023624.0E-9787IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-16786IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-15886IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.2E-24239340IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-24240340IPR015300DNA-binding pseudobarrel domain
CDDcd100172.35E-21245340No hitNo description
PROSITE profilePS5086313.817247342IPR003340B3 DNA binding domain
SMARTSM010198.0E-19247342IPR003340B3 DNA binding domain
PfamPF023628.0E-17250340IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGPNLTFSCM QRIPDNFIKK FANDLTHLVR LTVPDGHVWR IGIVKADDKF WFHDGWNDFV  60
ESYSIRVGYL LGFRYEGNAI FNVHMLYFSA SEMYFLTNTL SGKRCLLFDD LDDEDSTEYL  120
NSVPVYQVPY AMKANNAHLS RVNNVPQPAS QPVVEPNLQF NAFDHQHNAS SDAAPPAKVP  180
KKRGRKRKKP DPNADEEQAS AARPQEDGEM KFRFYESASA RKRTVTAEER ERAISAAKTF  240
EPENPFCRVV LRPSYLYRGC IMYLPSSFAE KNLNGVSGFI KLQFTDGKQW PVRCLYKGGR  300
AKLSQGWYEF TLENNIGEGD VCVFEMLKSR DVVLKVTVFR VMDSSAGYMN LNHHRMPVPP  360
PPAAAAGRH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-7421334115142B3 domain-containing transcription factor VRN1
4i1k_B2e-7421334115142B3 domain-containing transcription factor VRN1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184188RKRKK
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of vernalization. Acts as transcriptional repressor of FLC, a major target of the vernalization pathway. Binds DNA in vitro in a non-sequence-specific manner. {ECO:0000269|PubMed:12114624}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10027940
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021643265.11e-157B3 domain-containing transcription factor VRN1-like isoform X3
SwissprotQ8L3W11e-127VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A2C9U6Q91e-154A0A2C9U6Q9_MANES; Uncharacterized protein
STRINGLus100279400.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-122B3 family protein
Publications ? help Back to Top
  1. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]
  2. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]