PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 755aa    MW: 83263.7 Da    PI: 5.0803
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027437genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.8e-2053108156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t+ q++eLe+ F+++++p++++r eL++klgL++rq+k+WFqNrR++ k
  Lus10027437  53 KKKYHRHTQFQITELEKSFKECPHPDEKQRLELSRKLGLETRQIKFWFQNRRTQLK 108
                  79999***********************************************9987 PP

2START163.51.6e-512524792206
                  HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
        START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  +a++a++el+ +++ +ep+W+k +       e++n de+ ++ +++ +     + +ea+r++g v  ++  lve l+d++ +W  t+     + +++e
  Lus10027437 252 FALAAMNELFNMVQTDEPLWMKCPelgtgdrEMLNLDEYARIAVPTLGlkrsgFVIEASRETGTVMINSFALVEMLMDVN-RWVGTFSslvaRSSIIE 348
                  5789***************************************99888999999**************************.99999999999****** PP

                  EECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
        START  84 vissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                  vis g       g+lqlm+a+lq++splvp R   f+R+++q ++g+w++vdvS+ +  + ++s s+  + +lpSg++i++++ng+skvtwveh +++
  Lus10027437 349 VISYGsvngskdGTLQLMQADLQVISPLVPaRQTKFLRFCKQRSEGVWAVVDVSIGVSHEGSSSYSLPTSMRLPSGCVIQDMPNGYSKVTWVEHSEYD 446
                  *************************************************************99889999999************************** PP

                  SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                  + ++h +l+++++sg  +ga +w++tlqr+ce+
  Lus10027437 447 ETSIHRMLQPVISSGKGFGAGRWLSTLQRYCEC 479
                  *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2039110IPR009057Homeodomain-like
SuperFamilySSF466893.09E-2045110IPR009057Homeodomain-like
PROSITE profilePS5007117.94550110IPR001356Homeobox domain
SMARTSM003891.5E-1852114IPR001356Homeobox domain
PfamPF000461.3E-1753108IPR001356Homeobox domain
CDDcd000869.22E-2053110No hitNo description
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PROSITE profilePS5084839.036242482IPR002913START domain
SuperFamilySSF559612.53E-27245480No hitNo description
CDDcd088751.72E-96246478No hitNo description
SMARTSM002345.9E-36251479IPR002913START domain
PfamPF018522.6E-44252479IPR002913START domain
SuperFamilySSF559611.76E-15512748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MEVHGDQSFD ANSLLGRLNR EDESGSDNNL FEGNGSGDDE ADVDQEQQQR HKKKKYHRHT  60
QFQITELEKS FKECPHPDEK QRLELSRKLG LETRQIKFWF QNRRTQLKTQ LERHDNVMMR  120
QENDKLKAEN EMLRQGLGDP LCHNCGGPVV PGHVSFEQQQ LRIENARLKD ELGRVCSLVS  180
KYLGVPISPS FVVPPSPYAS NGYGPMSTNV DGTPLPMGID FADPCIAGVL PMMRQPSSDE  240
VSSLEKPMFA DFALAAMNEL FNMVQTDEPL WMKCPELGTG DREMLNLDEY ARIAVPTLGL  300
KRSGFVIEAS RETGTVMINS FALVEMLMDV NRWVGTFSSL VARSSIIEVI SYGSVNGSKD  360
GTLQLMQADL QVISPLVPAR QTKFLRFCKQ RSEGVWAVVD VSIGVSHEGS SSYSLPTSMR  420
LPSGCVIQDM PNGYSKVTWV EHSEYDETSI HRMLQPVISS GKGFGAGRWL STLQRYCECL  480
NIIMSSSTMP EDPSLMTLAG KKSVLRLSHR MVDNFCSGVV SGGDIGGHKW ERMEANDVSQ  540
DVKILARKSL SEPGEPSGVV LAVSTSVWLP VSRQRLFDFL SDNRTRKEWD ILTNGGLMHE  600
VIRIPKASTG GNCISLLRSV DVDPSTVSEA TKETVILQEI WHDASGSLLV YTPVDVPSME  660
MVMNGGDNTF ASLLPCGFAI LPDGRDQQNL SMATAESNGV GDIVEAGGCI LTIGFQIIVN  720
TLPGGKLSIE SIDTVNNLLS CTLQRIKDPL QVMT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10027437
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090292.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_012090293.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
TrEMBLA0A067JEK70.0A0A067JEK7_JATCU; Uncharacterized protein
STRINGLus100274370.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1