PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 199aa    MW: 21468.3 Da    PI: 9.4976
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027404genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.21e-28352251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +ien++ rqvtfskRrng+lKKA+ELSvLCdaev v++fs++g+lye+ss
  Lus10027404  3 KIENTTSRQVTFSKRRNGLLKKANELSVLCDAEVGVVVFSQRGRLYEFSS 52
                 69**********************************************96 PP

2K-box31.95.5e-1273128560
        K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLek 60 
                  s++s+++  +++l+qe+a L ++i+ Lq + R+llGe+Le ++l+e++   ++Le+
  Lus10027404  73 SNSSAASCIQQQLKQESASLANKIDLLQASTRRLLGEGLECCTLEEIKDTNDKLET 128
                  455566667899***************************************99996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.5E-30153IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-29184IPR002100Transcription factor, MADS-box
CDDcd002651.46E-36165No hitNo description
PROSITE profilePS5006627.768154IPR002100Transcription factor, MADS-box
PfamPF003191.2E-26350IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-171631IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-173152IPR002100Transcription factor, MADS-box
PfamPF014865.4E-981130IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MRKIENTTSR QVTFSKRRNG LLKKANELSV LCDAEVGVVV FSQRGRLYEF SSHGMDKTIA  60
RYKKYATVEI NRSNSSAASC IQQQLKQESA SLANKIDLLQ ASTRRLLGEG LECCTLEEIK  120
DTNDKLETRE GTARKEGKSV RKGTCGEMPW EPPPSIGGKG KEAVATAGSS NGASNDSSTV  180
VVTTLSIGLP TATHYIGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-17384990Myocyte-specific enhancer factor 2A
3kov_B2e-17384990Myocyte-specific enhancer factor 2A
3kov_I2e-17384990Myocyte-specific enhancer factor 2A
3kov_J2e-17384990Myocyte-specific enhancer factor 2A
3p57_A2e-17384990Myocyte-specific enhancer factor 2A
3p57_B2e-17384990Myocyte-specific enhancer factor 2A
3p57_C2e-17384990Myocyte-specific enhancer factor 2A
3p57_D2e-17384990Myocyte-specific enhancer factor 2A
3p57_I2e-17384990Myocyte-specific enhancer factor 2A
3p57_J2e-17384990Myocyte-specific enhancer factor 2A
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10027404
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100274041e-145(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.48e-38AGAMOUS-like 42