PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026588
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 110aa    MW: 12593.5 Da    PI: 4.9064
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026588genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM54.34.4e-17960153
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53
                 lp G+rF+Ptdeel+++yL+ k++g+  e+ ++++e+d++++ePwdLp++v++
  Lus10026588  9 LPLGYRFQPTDEELITHYLRLKINGRYSEV-DAVPEIDVCRWEPWDLPAQVYT 60
                 699************************999.99***************64443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-17563IPR003441NAC domain
PROSITE profilePS5100518.0669109IPR003441NAC domain
PfamPF023655.5E-81068IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MSALAVKSLP LGYRFQPTDE ELITHYLRLK INGRYSEVDA VPEIDVCRWE PWDLPAQVYT  60
IDEKENDKTR RIKISANVAG LEMFAGLEML LLNSQELNCQ LARRRNDVV*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10026588
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016716496.14e-25PREDICTED: NAC domain-containing protein 14-like isoform X1
RefseqXP_016716497.15e-25PREDICTED: NAC domain-containing protein 14-like isoform X2
RefseqXP_016716498.15e-25PREDICTED: NAC domain-containing protein 14-like isoform X3
RefseqXP_016716500.15e-25PREDICTED: NAC domain-containing protein 14-like isoform X5
RefseqXP_017649420.15e-25PREDICTED: NAC domain-containing protein 14 isoform X1
RefseqXP_021633205.13e-25protein NTM1-like 9
RefseqXP_021674121.14e-25protein NTM1-like 9
SwissprotF4JN353e-25NTL9_ARATH; Protein NTM1-like 9
TrEMBLA0A1R3K6N44e-24A0A1R3K6N4_9ROSI; No apical meristem (NAM) protein
STRINGLus100265884e-76(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16106410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.21e-27NAC transcription factor-like 9
Publications ? help Back to Top
  1. Zheng XY, et al.
    Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73
    [PMID:26139525]
  2. Guo T, et al.
    Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana.
    Mol Plant, 2017. 10(10): p. 1334-1348
    [PMID:28943325]