PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026373
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 305aa    MW: 34777.2 Da    PI: 5.216
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026373genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.5e-5561331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+s +
  Lus10026373   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELSeKsFLPSKDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVVS-Q 101
                  79****************************.99**************84335556788**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLv+y+grap+g +tdWvmheyr+
  Lus10026373 102 TRVIGMKKTLVYYRGRAPQGLRTDWVMHEYRV 133
                  99****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-644156IPR003441NAC domain
PROSITE profilePS5100560.1616156IPR003441NAC domain
PfamPF023653.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWE LSEKSFLPSK  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVVS QTRVIGMKKT LVYYRGRAPQ  120
GLRTDWVMHE YRVDDKDCED TSGLQDSYAL CRVFKKNGIC TETAEQEIQQ SFVYGGGGAT  180
SSSTARRNRT SPAAIMETAP DQAAMHNDIN HIMIDQYNNN DSTMSPDVPV NASSSSCLDD  240
DEKDVDDNSW MQFITDDDPW SSSSVVNGGD DVTYQQQQQQ PQVHHNHHQQ HHRQVSANTS  300
TFTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-54415713169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10026373
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126172e-35CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374257.11e-130NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI53e-89NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A2P5CQG01e-130A0A2P5CQG0_TREOI; NAC domain containing protein
STRINGLus100263730.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-120NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]