PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family TALE
Protein Properties Length: 275aa    MW: 31328.4 Da    PI: 6.5885
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024485genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.52e-072232562154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Lus10024485 223 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 256
                  468*****************************87 PP

2ELK25.62.8e-09177198122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK +L++++++++ ++++E++
  Lus10024485 177 ELKIELKQGFKSRIEDVREEIL 198
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037901.4E-52138IPR005540KNOX1
SMARTSM012562.4E-1955110IPR005541KNOX2
PfamPF037915.5E-1559109IPR005541KNOX2
PROSITE profilePS512139.132177197IPR005539ELK domain
PROSITE profilePS5007111.612197260IPR001356Homeobox domain
SuperFamilySSF466894.11E-16199264IPR009057Homeodomain-like
SMARTSM003892.3E-10199264IPR001356Homeobox domain
CDDcd000861.20E-11200261No hitNo description
Gene3DG3DSA:1.10.10.607.3E-25204262IPR009057Homeodomain-like
PfamPF059208.9E-18217256IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MQEPSLGMMG GGEMEQSSRE VKAEIATHPL YEQLLGAHWL SQSHHLLRSY AGSGCNLTPH  60
ERQDLDNFLA QYLIVLCGFK EQLQQHVRVH AVEAVMPCRE IETSFQSLTG MSLGEGTGAT  120
MSDDEDDQSM HMDFSLDQPG LMTSSSSVGD AHDMMMGFGP LLPTESERSL MERVRQELKI  180
ELKQGFKSRI EDVREEILRK RRAGKLPGDT TTVLKNWWQQ HSKWPYPTED DKAKLVEETG  240
LQLKQINNWF INQRKRNWHT NSQSVTSLKS KRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253273RKRNWHTNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10024485
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143939.11e-155PREDICTED: homeobox protein knotted-1-like 7
RefseqXP_007209425.11e-155homeobox protein HD1
SwissprotQ9FPQ81e-143KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A2P5CSP51e-155A0A2P5CSP5_TREOI; Knotted-like homeobox transcription factor
STRINGLus100244850.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-141KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]