PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 366aa    MW: 39166 Da    PI: 8.3262
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023818genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.32.2e-4374149176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dls++k y++rhkvC +hsk+p+v+v+g eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+
  Lus10023818  74 RCQVEGCNVDLSDVKPYYSRHKVCGIHSKTPTVIVAGSEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRKP 149
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-3467136IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.35972149IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-4173154IPR004333Transcription factor, SBP-box
PfamPF031101.7E-3275148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDIGGGGYFP NSDSSPPTSS SSSSAADSNN GLKFGKKIYF CDHVGLLNST PPNPKPAGSS  60
SRKVANQQQL QTPRCQVEGC NVDLSDVKPY YSRHKVCGIH SKTPTVIVAG SEQRFCQQCS  120
RFHLLPEFDQ GKRSCRRRLA GHNERRRKPP PGSMLSSSYG RLSSTLFENS GRGNGGGGGG  180
GGGFLLDFTS FPRSSGREAN NDETHFNLWQ NSSSQNPPPP NIYTQVSTGF SIHPGECYSI  240
ADSSCALSLL SNEQQWSSSR SRPSSHTAVG NLVDSEAPPV ATLSTAAATT ISPYQNTWGF  300
KGGGTNAFGS SHGMLQSDLG LGQIQPHSAT GSELDMSLLS RRQYMELEEN SRPYGSSDQH  360
INWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29751481184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10023818
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744450.0JX174445.1 Linum usitatissimum clone LuBAC364K11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021283494.11e-103squamosa promoter-binding-like protein 9
TrEMBLI6Y9J31e-175I6Y9J3_LINUS; SBP domain-containing protein
STRINGLus100238180.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.16e-43squamosa promoter binding protein-like 9