PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 412aa    MW: 46184.2 Da    PI: 7.0674
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023537genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.6e-50461731128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv++yL++kv +k++++ ++i+evdiy+ ePw+L   +++k++++ewyf+   d+ky +g r nrat +gyWkatgkd+ + + +
  Lus10023537  46 LAPGFRFHPTDEELVSYYLRRKVGSKPVRF-NAIAEVDIYRNEPWELAdkSRLKTRDQEWYFYGALDRKYGNGGRMNRATGTGYWKATGKDRGIRR-D 141
                  579************************999.89**************75348899999*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++l+ +kktLvf++grap g++t+Wvmheyrl
  Lus10023537 142 NQLIAMKKTLVFHNGRAPGGHRTNWVMHEYRL 173
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-5841198IPR003441NAC domain
PROSITE profilePS5100556.43446197IPR003441NAC domain
PfamPF023651.4E-2548173IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MAPQSEIPNA LPLPPAAAAA STATFALAPA APPRKTQPAA SSTTALAPGF RFHPTDEELV  60
SYYLRRKVGS KPVRFNAIAE VDIYRNEPWE LADKSRLKTR DQEWYFYGAL DRKYGNGGRM  120
NRATGTGYWK ATGKDRGIRR DNQLIAMKKT LVFHNGRAPG GHRTNWVMHE YRLVDEELER  180
IGNLQGDSFV LCRVFHKNNI GPPNGNRYAP FMEEEWDDDN KPVLVPGEDV ADERVACSEA  240
YAEMNRVEQD KLSISKEPFD VNEVPKVTRD LLSLCKNETV EEMEELDAPM TSAHPPQPQQ  300
TRSHRRPPPP PPPTTAISAL LEFSLMEPKE RTPSPKKPTS SSSASLESLV PSGCMKLIND  360
LQSEVHKVSV DRETLKLELM RANAMANILQ SRIDHLNEEN KDLKRNLREG H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-474519919170NAC domain-containing protein 19
3swm_B5e-474519919170NAC domain-containing protein 19
3swm_C5e-474519919170NAC domain-containing protein 19
3swm_D5e-474519919170NAC domain-containing protein 19
3swp_A5e-474519919170NAC domain-containing protein 19
3swp_B5e-474519919170NAC domain-containing protein 19
3swp_C5e-474519919170NAC domain-containing protein 19
3swp_D5e-474519919170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10023537
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081001.11e-166NAC domain-containing protein 82 isoform X2
SwissprotQ9SQX91e-109NAC50_ARATH; NAC domain containing protein 50
TrEMBLR4NFV51e-165R4NFV5_JATCU; NAC transcription factor 043
STRINGLus100235370.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-109NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]