PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 156aa    MW: 17761.2 Da    PI: 5.2735
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023434genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.73.8e-387103197
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                  +Ca+Ck+lrr+Ca+dCvlapyfp ++p++f+ vhk+FGasn+++ll+++p e+r +a++++ +eA arar+PvyG++g+i++lqq++ +++ e++ +
  Lus10023434   7 RCAGCKYLRRRCAQDCVLAPYFPPDNPQRFESVHKIFGASNLTRLLQEVPVETRGKAADCMSFEASARAREPVYGCAGMIHELQQEILKVQFEVENI 103
                  6****************************************************************************************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4156107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-377102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MSSNGRRCAG CKYLRRRCAQ DCVLAPYFPP DNPQRFESVH KIFGASNLTR LLQEVPVETR  60
GKAADCMSFE ASARAREPVY GCAGMIHELQ QEILKVQFEV ENIEGMLALH RAEHQLLVMR  120
QQEKKNMLLD DDDVDFGGHY NLDLEGDDQF LWQLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-3351019105LOB family transfactor Ramosa2.1
5ly0_B1e-3351019105LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10023434
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316444.34e-50LOB domain-containing protein 24
TrEMBLA0A2K1YZY86e-49A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGLus100234341e-113(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-41LOB domain-containing protein 23