PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022506
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 350aa    MW: 38893.1 Da    PI: 4.6502
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022506genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.62.5e-26958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien +nrqvtfskRrng++KKA+EL +LCd+++a+i+fs++g+l  +s
  Lus10022506  9 KRIENITNRQVTFSKRRNGLIKKAYELAILCDIDIALIMFSPSGRLSHFS 58
                 79********************************************9997 PP

2K-box14.21.8e-06107182681
        K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 
                  + + ++++ e lqqe+  L+++++  + ++  +  + L+  s+ +L++ e++L +s+++  ++K+ ll +++++  
  Lus10022506 107 NPESTNSNIEVLQQEVCSLQRQLQVAEDQLNVYEPNPLKFSSIGDLESCEKNLLDSMSRLEERKKYLLSNHVSTYD 182
                  445788999999**********9999999999999************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.8E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.184161IPR002100Transcription factor, MADS-box
CDDcd002651.71E-35275No hitNo description
SuperFamilySSF554552.09E-29289IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRVKLQIKR IENITNRQVT FSKRRNGLIK KAYELAILCD IDIALIMFSP SGRLSHFSGK  60
RRIEDVIARY INLPDHDREC DVMNREDLLK TLKDLKSQND TAFQATNPES TNSNIEVLQQ  120
EVCSLQRQLQ VAEDQLNVYE PNPLKFSSIG DLESCEKNLL DSMSRLEERK KYLLSNHVST  180
YDHSSMQILF DGRDDLPNFD SDIANWLPDN GHNQNSVHVV SESSCIPVSN QSTATIFEAL  240
SQGNGNVDPC NNMGGGNNMN NSNGESISPW HQAFSSLSST ELLAAFLPPT SFAPIKQQEV  300
EGPSYTSMLQ QQQQQAADAQ SNCPQQQIPS SNGGDGSDYD QNLCPQSST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-16193189Myocyte-specific enhancer factor 2B
1tqe_Q2e-16193189Myocyte-specific enhancer factor 2B
1tqe_R2e-16193189Myocyte-specific enhancer factor 2B
1tqe_S2e-16193189Myocyte-specific enhancer factor 2B
6byy_A2e-16193189MEF2 CHIMERA
6byy_B2e-16193189MEF2 CHIMERA
6byy_C2e-16193189MEF2 CHIMERA
6byy_D2e-16193189MEF2 CHIMERA
6c9l_A2e-16193189Myocyte-specific enhancer factor 2B
6c9l_B2e-16193189Myocyte-specific enhancer factor 2B
6c9l_C2e-16193189Myocyte-specific enhancer factor 2B
6c9l_D2e-16193189Myocyte-specific enhancer factor 2B
6c9l_E2e-16193189Myocyte-specific enhancer factor 2B
6c9l_F2e-16193189Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10022506
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021650890.11e-158agamous-like MADS-box protein AGL104
TrEMBLA0A067LHN71e-156A0A067LHN7_JATCU; Uncharacterized protein
STRINGLus100225060.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85252735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-76AGAMOUS-like 104