PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 337aa    MW: 37584.5 Da    PI: 8.1234
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021659genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.5e-55221471128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL +kv + ++++ ++i +vd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
  Lus10021659  22 LPPGFRFHPTDEELISHYLYNKVIDVRFSC-RAIGDVDLNKSEPWELPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKS 117
                  79****************************.89***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfykgrapkgek++Wvmheyrl
  Lus10021659 118 LVGMKKTLVFYKGRAPKGEKSNWVMHEYRL 147
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-6417172IPR003441NAC domain
PROSITE profilePS5100559.04522172IPR003441NAC domain
PfamPF023653.3E-2923147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MENNVACGVG MVMEEEDDQM DLPPGFRFHP TDEELISHYL YNKVIDVRFS CRAIGDVDLN  60
KSEPWELPWK AKMGEKEWYF FCVRDRKYPT GLRTNRATEA GYWKATGKDK EIYRGKSLVG  120
MKKTLVFYKG RAPKGEKSNW VMHEYRLDGK FSIHNLPKTA KNEWVICRVF QKTCGGKKIH  180
ISGITRFGEL QGHHHNSSSM LPPLMESPSA NYDQKFTIKP AVAAESSSAY VPCFSNLITN  240
MNTTNNSSTS SSQFLSNPII PSSSSSSIPL FPSSHYNSQL IPSANFGQYN DNSILLRALM  300
ADKQGGGGGS SLNLMNSTEI SPSATGPVDL DSIWDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5481781171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5481781171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5481781171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5481781171NO APICAL MERISTEM PROTEIN
4dul_A2e-5481781171NAC domain-containing protein 19
4dul_B2e-5481781171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10021659
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080293.11e-134NAC domain-containing protein 100
RefseqXP_017972125.11e-134PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-123NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A061FWI71e-133A0A061FWI7_THECC; NAC domain protein, IPR003441
TrEMBLR4N7I91e-133R4N7I9_JATCU; NAC transcription factor 002
STRINGLus100216590.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-116NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]