PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 418aa    MW: 45634.8 Da    PI: 8.3479
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021614genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.7e-41164241178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v+vsgle+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrr++q+
  Lus10021614 164 CCQVEGCNLDLKSAKDYHRRHRICESHSKSPKVVVSGLERRFCQQCSRFHQLSEFDDKKRSCRRRLSDHNARRRRPQP 241
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.6E-34158226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.949162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.0E-39163245IPR004333Transcription factor, SBP-box
PfamPF031102.8E-32165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MSHSGRAAID SPSLTSCVAM DWNLKSASEW DWDTLYGFSS RTCGTQKQQV NHLNPDAEGE  60
GVGRIDSGFI YSDGCGGGFS GSDSGYGSSS KSSVSASVGS PSKEGLQTRN AVEGLSNVNK  120
VSSGEHVIGL KLGKRTYFGD VCTTKSVVAA KRPRSSCQSA QSPCCQVEGC NLDLKSAKDY  180
HRRHRICESH SKSPKVVVSG LERRFCQQCS RFHQLSEFDD KKRSCRRRLS DHNARRRRPQ  240
PDAIQFNNRR QMNRVALRAK SFTWPSGCGF DSLPKIVKSE GMSRQMSNLS INDVHEEMIS  300
DKGLSFKSST PQIFSEGLEC SPSTCNLEMN PNFGGALSLL STTSSWGLNE PTALEQLMLV  360
NDTGMAHQTM IHAAEPQSWS LSPSAANAFD GNITSLQQFH QCKTPYQLGS FYSNQTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-281652381184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1220237KKRSCRRRLSDHNARRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10021614
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8885771e-89HQ888577.1 Linum usitatissimum clone GMU2AYZ01AS0MU microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023874058.11e-103LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 3
TrEMBLA0A2I6SET71e-110A0A2I6SET7_9ROSI; SBP-box transcription factor
STRINGLus100216140.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-48squamosa promoter binding protein-like 2