PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 521aa    MW: 57220.3 Da    PI: 6.866
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021141genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.85.7e-42172247277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls+ keyh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Lus10021141 172 CQVYGCNKDLSSSKEYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLPEFDDGKRSCRKRLAGHNERRRKPQ 247
                  **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.2E-33165233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.0E-39170249IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MEYSSYGSNG TAAFVSSETT MSSSSSDTFT RSRTGSLLDW DLRRALVSSA PFVENQSFGE  60
MWGYCHHEVV AKALPLPHGS VRYHLNSKGE TEECIKNPFV VSSSALCLED ESSSRLSVSS  120
SVLEYSTNSS KDHSSASFID LKLGRVGDPS KLYTPPKRAR FGGANSNAAA HCQVYGCNKD  180
LSSSKEYHKR HKVCDVHSKT AKVIVNGIEQ RFCQQCSRFH LLPEFDDGKR SCRKRLAGHN  240
ERRRKPQVGL HSGRAARLIQ AYNGFPNGRI QETGLTSSFI CQDILPETLL YPERYNANEY  300
WFRRVKHEDE ESNMSPNLSG IHHLQSEQPL YPFEKMFPAF ADGVVTTPSG SIFSENSNRY  360
PLDVGGSNSS SHCLVPQGTS SLGNDEFITL DAAASVTIQG LSGVTIADSS STGCALSLLS  420
SQSQSSSSSQ SSGIPLAGHH YSMNHQQQVS GRMIRFGLST EASHLMSPLL LSHLEDNNTN  480
GEDTTTIDLL QLSSQLHRVE HEKQKSLQQL EQDAAEGYHW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29162245184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10021141
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021665393.11e-127squamosa promoter-binding-like protein 6 isoform X4
TrEMBLA0A067K5H81e-127A0A067K5H8_JATCU; Uncharacterized protein
STRINGLus100211410.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-44SBP family protein