PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021064
Common NameHAT14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 253aa    MW: 27772.7 Da    PI: 8.2034
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021064genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-1880134256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Lus10021064  80 RKKLRLSKDQSAFLEESFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 134
                  778899***********************************************98 PP

2HD-ZIP_I/II127.55.6e-4180169191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Lus10021064  80 RKKLRLSKDQSAFLEESFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 169
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-1864130IPR009057Homeodomain-like
SuperFamilySSF466891.84E-1871137IPR009057Homeodomain-like
PROSITE profilePS5007117.32976136IPR001356Homeobox domain
SMARTSM003892.8E-1678140IPR001356Homeobox domain
CDDcd000861.35E-1680137No hitNo description
PfamPF000464.1E-1680134IPR001356Homeobox domain
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PfamPF021834.5E-11136170IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.3E-24136180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MPAVVTSSDH GAGDGSRRFD VNRLSAEEGD DVDGASLSSP NSAASSFQME FGIGLGSKRD  60
LEGDRAGSRA SDDDENGSTR KKLRLSKDQS AFLEESFKEH STLNPKQKQA LAKQLNLRPR  120
QVEVWFQNRR ARTKLKQTEV DCEYLKRCCE TLTEENRRLQ KELQELRALK TNSQPFYMQP  180
PATTLTMCPS CERVATTTTT TAGGNNKPTT KSSSSTALSL GNISNNGRAV YPFSDVQLQM  240
SQQNQPNQPA DS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884TRKKLRL
2128136RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10021064
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744450.0JX174445.1 Linum usitatissimum clone LuBAC364K11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534537.11e-102homeobox-leucine zipper protein HOX11
RefseqXP_024459020.11e-102homeobox-leucine zipper protein HAT14
SwissprotP466655e-87HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLI6YHV30.0I6YHV3_LINUS; Putative homeobox-leucine zipper protein
STRINGLus100210640.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-82homeobox from Arabidopsis thaliana