PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 374aa    MW: 39898.7 Da    PI: 8.7256
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021034genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.21.2e-4379154176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dls++k y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+
  Lus10021034  79 RCQVEGCNVDLSDVKPYYSRHKVCGIHSKTPTVIVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRKP 154
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3471141IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.54777154IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.5E-4278159IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3280153IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MDIAGGGGGG GYFANSDSSP PTSSSSSSAA DSNNGLKFGK KIYFGDHVGL LNSTPPNPKP  60
AGSSSRKVAN QQQQQTTPRC QVEGCNVDLS DVKPYYSRHK VCGIHSKTPT VIVAGLEQRF  120
CQQCSRFHLL PEFDQGKRSC RRRLAGHNER RRKPPPGSML SSRYGRLSST LFDNNSRGSG  180
GGGGGGGGGG FLLDFTSFPR SSGREANNNE THHNLWQNRS SQNPPPPNIY SQVSTGFSIH  240
PGECYSIADS SCALSLLSNE QQWSSSRSRP SSHTAVGNLV DSEAPPIATL STAAAATTIS  300
PYQNTWGFKG GGTDTFSSSH GMLQSDLGLG HVQPHSATGS ELDMSLLSRR QYMDMEEHSR  360
PYGSSDHHIN WSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29801531184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10021034
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744450.0JX174445.1 Linum usitatissimum clone LuBAC364K11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322678.31e-103squamosa promoter-binding-like protein 9
TrEMBLI6Y9J31e-134I6Y9J3_LINUS; SBP domain-containing protein
STRINGLus100210340.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-52squamosa promoter binding protein-like 9