PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 399aa    MW: 43457.8 Da    PI: 4.8736
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020896genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.31.9e-4671351129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l pGfrFhPtd elv +yLk+kv gkkl++ ++i+e+diyk+ PwdLp k  +++++ +wyfF++r+kkya g r +ra++ gyWk+tgkd++vl  +
  Lus10020896   7 LSPGFRFHPTDVELVRFYLKRKVMGKKLPF-HCITELDIYKHAPWDLPlKsVLRTGDLKWYFFCPREKKYAIGPRMKRAAEGGYWKSTGKDRPVLY-D 102
                  579**************************9.89***************6445666888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  +e+ g+ +tLvf+ g+ pkge+tdWvm eyrle
  Lus10020896 103 NEVAGMIRTLVFHLGKPPKGERTDWVMYEYRLE 135
                  99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-533157IPR003441NAC domain
PROSITE profilePS5100550.517157IPR003441NAC domain
PfamPF023651.7E-249134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MVGSARLSPG FRFHPTDVEL VRFYLKRKVM GKKLPFHCIT ELDIYKHAPW DLPLKSVLRT  60
GDLKWYFFCP REKKYAIGPR MKRAAEGGYW KSTGKDRPVL YDNEVAGMIR TLVFHLGKPP  120
KGERTDWVMY EYRLEDKKLI DSGVSQDSYV LSVLFKKDGP GPKNGAQYGA PFKEEEWESD  180
DEEDEVNDGI GAALWAGAST PSTVLSIERT NSAVTSPVVP DGSCVVSQVS CPAEKENAYV  240
VGPVGLDNTN ASEGVAQALH GGLEDVFSAA PLAFQLNPQG EYCASGGTFQ AQHSPQTVHV  300
ASEEHGEAVH TGFEPVAEND DVLAMLDYFT EEAPFTLDQL NNTEQKGTVI ENVNKAEAQG  360
GGEPGEAGAV GGRVGVQFKE GKAEMAGFPS YKLNWLGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-41715715168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10020896
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021632958.11e-103NAC domain-containing protein 82-like
SwissprotQ9FY822e-87NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A0M3R8511e-101A0A0M3R851_MANES; NAC transcription factors 13
STRINGLus100208960.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-84NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]