PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 398aa    MW: 43624.3 Da    PI: 9.0394
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020165genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12e-54311591128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  lppGfrFhPtdeel+++yL +k+++  +++ +++++vd++k+ePwdLp k+k +ekewyfFs+rd+ky+tg r+nrat+ gyWk+tgkdke++++  +
  Lus10020165  31 LPPGFRFHPTDEELITYYLVNKIADAGFSA-RAVADVDLNKSEPWDLPGKAKMGEKEWYFFSQRDRKYPTGVRTNRATNMGYWKTTGKDKEIFNTqsS 127
                  79***************************9.88***************99999****************************************98778 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  gelvg+kktLvfykgrap+gek++Wvmheyr+
  Lus10020165 128 GELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 159
                  889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-6326181IPR003441NAC domain
PROSITE profilePS5100561.42131181IPR003441NAC domain
PfamPF023658.5E-2932159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MNQPTTSNDH KGKGHSGNNA NDGTGTDDQK LPPGFRFHPT DEELITYYLV NKIADAGFSA  60
RAVADVDLNK SEPWDLPGKA KMGEKEWYFF SQRDRKYPTG VRTNRATNMG YWKTTGKDKE  120
IFNTQSSGEL VGMKKTLVFY KGRAPRGEKS NWVMHEYRIH SKSSFRPSKQ EEWVVCRVFK  180
KSPGGVNKNK FPPYTPIINN SSSTTSHYYY QHQHHQSRSS LMNPYTASTT ETTLLSQPFT  240
GQRPTNYSSN VNNMMMTSSE LADLTRAFRA GTSSAAGSST MMMMTDVNNN NNNFYYPAAT  300
IAGLNLNLGG GGGGGTSLMN NNINNVAAGG GASSSAMMMM EMMNTPFPDE GSSGTFPGGS  360
TNGDQLIINN SAAGPNSFMG NVDNCMDFDT YWPPSNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-563118217166NO APICAL MERISTEM PROTEIN
1ut4_B5e-563118217166NO APICAL MERISTEM PROTEIN
1ut7_A5e-563118217166NO APICAL MERISTEM PROTEIN
1ut7_B5e-563118217166NO APICAL MERISTEM PROTEIN
4dul_A5e-563118217166NAC domain-containing protein 19
4dul_B5e-563118217166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10020165
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021912668.11e-117protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A2C9W4N01e-115A0A2C9W4N0_MANES; Uncharacterized protein
TrEMBLA0A2C9W4Q21e-115A0A2C9W4Q2_MANES; Uncharacterized protein
STRINGLus100201650.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-93NAC domain containing protein 38