PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 395aa    MW: 44703.9 Da    PI: 6.6455
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019819genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.21.2e-141051243
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  i+n++ r  t+ kR++ +lKK +E  vLCd+++++iif+++
  Lus10019819 10 LIKNDRSRMQTYKKRKANLLKKINEFTVLCDVKACIIIFGPN 51
                 59**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-12167IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.736151IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-18298IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-7323IPR002100Transcription factor, MADS-box
CDDcd002661.28E-18493No hitNo description
PfamPF003197.0E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGHKRVKMEL IKNDRSRMQT YKKRKANLLK KINEFTVLCD VKACIIIFGP NTNNNGSNQL  60
ELETWAPESC SIQDLIQQYR TSDQPRRCYS VSDYFAEKKK RVDVEIAKLR KQIHKQQFPT  120
EDGGDRFNRY SDDELKLILG SIDSKLEAAD QRIAALNAKR NLGIVHHQAV PITTWPQNNN  180
NLVEVGFGIE REFDDDDDVN VVHHQDLSRH CQYEQQNSVN ALLEQNSNHN NNYFDNYYQN  240
DNNNSFSFPA EGHNFFPEVP FCFQPGELTS PLMADFGSPE KGFNFGLMPA QRYPNFLMQP  300
EMTIKNQVVG RSNGMIHHGL LNSLPGTRTC TGTSSRLWNF DSAGSSDAGM SFIASSSYKQ  360
QFQVSPMAAG FANPRMFDES IGGGFEFGGG EHKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10019819
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100198190.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-18M-type_MADS family protein