PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Nin-like
Protein Properties Length: 303aa    MW: 34343.2 Da    PI: 6.4152
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019100genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.24.3e-25115163452
       RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   i+ e+ls+yF++pi++AAke++++lT+LK++CR++G++RWPhRk+ sl
  Lus10019100 115 VITREMLSRYFYMPITEAAKEMNMGLTLLKKRCRELGVRRWPHRKLMSL 163
                  6999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.68898183IPR003035RWP-RK domain
PfamPF020421.2E-20116163IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MELVEVKQEQ HHFQIRSPPL LHDDFELQAT FGGFFDDFTF SSHGGGDDDY YSSSSLPPFP  60
SFNHLFDLNS STNILHQSSS SSISSSSCSS HIDHHDPVPN ELGTPNKIVP TNGQVITREM  120
LSRYFYMPIT EAAKEMNMGL TLLKKRCREL GVRRWPHRKL MSLNTLISSV RHLLHNQQQG  180
DDGHEGLTRL GKLEESVRVL EHERRVLEEC PNLQLESNTK RLRQACFKAN YKRKHKHGVS  240
TKMIDHGDAS GRRGHRRTNV DVQDVSSTTN SDVVANLGCE NDDDGDEEIR SLLLPAEFDF  300
EF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10019100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8876102e-59HQ887610.1 Linum usitatissimum clone GMU2AYZ01A0ZA0 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027122331.16e-48protein RKD3-like
TrEMBLA0A2R6QH612e-50A0A2R6QH61_ACTCH; Uncharacterized protein
STRINGLus100191000.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-39RWP-RK domain-containing protein