PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 209aa    MW: 23721.5 Da    PI: 8.7981
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018610genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.3e-4185161177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cq+e+C++dls ak yhrrh+vCe hska+vvlvsgl+qrfCqqCsrfhel efD+ krsCrrrLa+hnerrrk++
  Lus10018610  85 CCQAEKCTNDLSVAKAYHRRHRVCEYHSKAQVVLVSGLRQRFCQQCSRFHELPEFDDMKRSCRRRLAGHNERRRKNA 161
                  6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3182147IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.37683160IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3685161IPR004333Transcription factor, SBP-box
PfamPF031103.8E-3186159IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEEGGKGKQK RTMVVKKEFD DDPADSSSDE YGSDQYLHQQ QGMGYFFDDD DSSESCKKKK  60
LVIGTGTTAT ASFAGGERRV AGGRCCQAEK CTNDLSVAKA YHRRHRVCEY HSKAQVVLVS  120
GLRQRFCQQC SRFHELPEFD DMKRSCRRRL AGHNERRRKN AAAESHPHHP PPHEGSSARK  180
EDTIMCDPRE RIKIVTAENP SYKHFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3481159684squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10018610
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021681200.17e-58squamosa promoter-binding protein 1-like isoform X1
SwissprotQ387411e-37SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLB9RVW35e-53B9RVW3_RICCO; Squamosa promoter-binding protein, putative
STRINGLus100186101e-154(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-38squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]