PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 355aa    MW: 38194.6 Da    PI: 9.1267
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018469genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.6e-53161431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelv +yLkkk+++ +l++ ++i++vd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++ls+ + 
  Lus10018469  16 LPPGFRFHPTDEELVIHYLKKKAASLPLPV-TIIADVDLYKFDPWELPGKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILSStGA 112
                  79****************************.89***************8888999**************************************99677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +vg+kk Lvfy g+ pkg kt+W+mheyrl
  Lus10018469 113 GKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 143
                  78***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-647183IPR003441NAC domain
PROSITE profilePS5100561.27716183IPR003441NAC domain
PfamPF023658.0E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MESTDSSSAT HHHPNLPPGF RFHPTDEELV IHYLKKKAAS LPLPVTIIAD VDLYKFDPWE  60
LPGKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPILSST GAGKVGVKKA  120
LVFYGGKPPK GIKTNWIMHE YRLVNNNYGG NSCTLLKPPV SNSGSKKSSL RLDDWVLCRI  180
YKKNTNLQNR PVDQRDYEHI NHHHQDSNSI EAMLASTTAT VKPAGSYASL LEGEENFFDG  240
MLTAAAATSG SAAAGVSFGM NNSSKRRIVI NDYWNSINGE TMSSSGGNKR FHGDLKTGGG  300
GGGGGGMEDS GGAANSFVSL MNQSNTAAFQ GGGIMGSLGD EDGVVLRQQF QFGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-731518916171NO APICAL MERISTEM PROTEIN
1ut4_B3e-731518916171NO APICAL MERISTEM PROTEIN
1ut7_A3e-731518916171NO APICAL MERISTEM PROTEIN
1ut7_B3e-731518916171NO APICAL MERISTEM PROTEIN
3swm_A3e-731518919174NAC domain-containing protein 19
3swm_B3e-731518919174NAC domain-containing protein 19
3swm_C3e-731518919174NAC domain-containing protein 19
3swm_D3e-731518919174NAC domain-containing protein 19
3swp_A3e-731518919174NAC domain-containing protein 19
3swp_B3e-731518919174NAC domain-containing protein 19
3swp_C3e-731518919174NAC domain-containing protein 19
3swp_D3e-731518919174NAC domain-containing protein 19
4dul_A3e-731518916171NAC domain-containing protein 19
4dul_B3e-731518916171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:17124321}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10018469
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021598060.11e-134NAC transcription factor 25-like
SwissprotA0SPJ91e-101NAM2_HORVV; NAC transcription factor NAM-2
TrEMBLA0A0M3R8651e-133A0A0M3R865_MANES; NAC transcription factors 83
STRINGLus100184690.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-101NAC domain containing protein 25
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]