PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Trihelix
Protein Properties Length: 95aa    MW: 10487.5 Da    PI: 10.9134
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018283genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix44.63.8e-1432871974
     trihelix 19 erlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtse 74
                 +++++++  + +W++v ++++++g+ rs++qC++kw+nl ++ykk++++  +r+ +
  Lus10018283 32 SSSGSKAGGELRWKWVEDYCWKKGCFRSQNQCNDKWDNLMRDYKKVRDHPPRRRHR 87
                 455556667889*************************************9988543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.1E-103782No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MWEWRGGGGE RGGEGGGGGG GGGGGGNSTT GSSSGSKAGG ELRWKWVEDY CWKKGCFRSQ  60
NQCNDKWDNL MRDYKKVRDH PPRRRHRRRN GSWR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10018283
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882939.13e-26uncharacterized protein LOC107418735 isoform X4
TrEMBLA0A103SX293e-24A0A103SX29_CYNCS; Uncharacterized protein
TrEMBLW9R7D12e-23W9R7D1_9ROSA; Uncharacterized protein
STRINGLus100182833e-58(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31310.11e-21Trihelix family protein