PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 305aa    MW: 34121.6 Da    PI: 6.9251
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018142genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.68.3e-5271311128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtd+elv++yL +k++++++++  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++     +
  Lus10018142   7 LPPGFRFHPTDDELVMHYLVRKCASQPISV-PIIAEIDLYKYDPWDLPGLALYGEKEWYFFSPRDRKYPNGTRPNRAAGTGYWKATGADKPIGL--PR 101
                  79****************************.88***************6555679*************************************99..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy+g+apkgekt+W+mheyrl
  Lus10018142 102 PVGIKKALVFYEGKAPKGEKTNWIMHEYRL 131
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-624157IPR003441NAC domain
PROSITE profilePS5100560.7197157IPR003441NAC domain
PfamPF023655.2E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSPALDLPPG FRFHPTDDEL VMHYLVRKCA SQPISVPIIA EIDLYKYDPW DLPGLALYGE  60
KEWYFFSPRD RKYPNGTRPN RAAGTGYWKA TGADKPIGLP RPVGIKKALV FYEGKAPKGE  120
KTNWIMHEYR LADVDRSARK KNSLRLDDWV LCRIYNKKGS IEKKSAPVAV SRRADSTDSI  180
EEKKPSLLMS STPVPQLPAT VAGGYQPAIN SYNNDYVCFE SSDSVPRMNT DSSCSEHVVS  240
PEFTTSEVQS EANWGMNNAS GGFDLGFNYM DAAMERELAS QFQGGAINQM SPLQDMFMYL  300
QKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-79516313174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10018142
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021604672.11e-153NAC domain-containing protein 2-like
SwissprotQ390131e-141NAC2_ARATH; NAC domain-containing protein 2
TrEMBLR4NER11e-154R4NER1_JATCU; NAC transcription factor 025
STRINGLus100181420.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-143NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]