PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 175aa    MW: 20315.2 Da    PI: 9.9404
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017871genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61e-30959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl++ys+
  Lus10017871  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSPKGKLFDYST 59
                 79***********************************************96 PP

2K-box1072.1e-3582172898
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   +++++  s++ e+akLk++ie Lq+++Rh+ Ge++++Ls++eLq+LeqqL+++lk+iRs+Kn+l++e+i+elqkk k+lqe+n++L kk+
  Lus10017871  82 PNDTQTCGSWTLEYAKLKARIEVLQKNLRHYNGEEIDTLSIRELQNLEQQLDSGLKHIRSRKNQLMHESISELQKKDKALQEQNNQLAKKV 172
                  466778889*******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.366161IPR002100Transcription factor, MADS-box
SMARTSM004327.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.57E-40279No hitNo description
SuperFamilySSF554552.49E-33286IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.26888174IPR002487Transcription factor, K-box
PfamPF014862.6E-2990172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFSP KGKLFDYSTD  60
SCMERILERH ERYSYADRNL VPNDTQTCGS WTLEYAKLKA RIEVLQKNLR HYNGEEIDTL  120
SIRELQNLEQ QLDSGLKHIR SRKNQLMHES ISELQKKDKA LQEQNNQLAK KVGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q9e-21174173Myocyte-specific enhancer factor 2B
1tqe_R9e-21174173Myocyte-specific enhancer factor 2B
1tqe_S9e-21174173Myocyte-specific enhancer factor 2B
6c9l_A9e-21174173Myocyte-specific enhancer factor 2B
6c9l_B9e-21174173Myocyte-specific enhancer factor 2B
6c9l_C9e-21174173Myocyte-specific enhancer factor 2B
6c9l_D9e-21174173Myocyte-specific enhancer factor 2B
6c9l_E9e-21174173Myocyte-specific enhancer factor 2B
6c9l_F9e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10017871
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8309230.0EU830923.1 Linum usitatissimum clone LU0019B03 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625854.11e-102PREDICTED: agamous-like MADS-box protein AGL8 homolog
RefseqXP_017973951.11e-102PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X3
SwissprotQ424291e-98AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A1S3YGF61e-100A0A1S3YGF6_TOBAC; agamous-like MADS-box protein AGL8 homolog
STRINGLus100178711e-126(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-91MIKC_MADS family protein
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]