PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family TALE
Protein Properties Length: 180aa    MW: 20675.3 Da    PI: 6.9791
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017824genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-071281612154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Lus10017824 128 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 161
                  469*****************************87 PP

2ELK26.41.6e-0982103122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK +L++++++++ ++++E++
  Lus10017824  82 ELKIELKQGFKSRIEDVREEIL 103
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.13282102IPR005539ELK domain
PROSITE profilePS5007111.677102165IPR001356Homeobox domain
SMARTSM003891.4E-10104169IPR001356Homeobox domain
SuperFamilySSF466891.45E-16104169IPR009057Homeodomain-like
CDDcd000866.15E-12105166No hitNo description
Gene3DG3DSA:1.10.10.602.7E-25109167IPR009057Homeodomain-like
PfamPF059204.5E-18122161IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MPNDEFFWVA GMSLGEGTGA TMSDDEDDQS MHMDFSLDPP GLMTSSSTSA VGDPHDMNMM  60
MGFGPLLPTE SERSLMERVR QELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTTVLK  120
NWWQQHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-13105161864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158178RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10017824
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238758.14e-99PREDICTED: homeobox protein HD1
SwissprotP466066e-91HD1_BRANA; Homeobox protein HD1
TrEMBLM5WA761e-97M5WA76_PRUPE; KNOPE7
STRINGLus100178241e-130(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.16e-93KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]