PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family VOZ
Protein Properties Length: 440aa    MW: 48474.8 Da    PI: 5.6011
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017700genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ362.71.3e-1111954111217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaf+gpkcalwdctrpaqgse   +yc s+h + a+ +g pg  p++rpkgi +kd+ lf+al+ak+qgkevgip+c gaa+++spwna++lfd+
  Lus10017700 195 PPPSAFMGPKCALWDCTRPAQGSESSMEYCCSLHCDAAVSDGGPGRPPTVRPKGIRMKDNFLFDALTAKIQGKEVGIPQCVGAASTRSPWNAPDLFDI 292
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeinelda.lalyrlelklvdekks 195
                  sl+e et+rew+ffd+pr+a++sg+rkqrslpdy+grgwhesrkqv+   g +krsyymdpqpsss+ewhlyey++ ++da +aly+le+kl+++kk+
  Lus10017700 293 SLFEEETLREWVFFDEPRKAYDSGSRKQRSLPDYKGRGWHESRKQVIS-PGCQKRSYYMDPQPSSSHEWHLYEYQVINSDAsCALYKLEYKLAEAKKT 389
                  **********************************************96.699***********************99999659*************** PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  ++gkvsk sladlq k+ rl+a
  Lus10017700 390 PRGKVSKASLADLQMKMNRLNA 411
                  *******************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MGGVLAGFPM QNGQKSKSHH HIKDIAKNWV NDHEGRLSDL RAAVREGRQR DFEVLAEQVF  60
QSIGELRTEL DAPTPASSLL VEDDATSVPA QFPVMEPQHG TEQINESHPL GDFTAYHDGF  120
LGSAGTQNHD FHGFDQTAGG FLDAFDSIET KPSDLSAYFD SDQYIDFDYG LPVDINPNKG  180
FIKETQSSKP SYVSPPPSAF MGPKCALWDC TRPAQGSESS MEYCCSLHCD AAVSDGGPGR  240
PPTVRPKGIR MKDNFLFDAL TAKIQGKEVG IPQCVGAAST RSPWNAPDLF DISLFEEETL  300
REWVFFDEPR KAYDSGSRKQ RSLPDYKGRG WHESRKQVIS PGCQKRSYYM DPQPSSSHEW  360
HLYEYQVINS DASCALYKLE YKLAEAKKTP RGKVSKASLA DLQMKMNRLN ADGTPDSSPS  420
NGSTKLNVKS ESSPSGTVP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10017700
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021691248.11e-149transcription factor VOZ1-like
TrEMBLB9IQS11e-147B9IQS1_POPTR; VOZ family protein
STRINGLus100177000.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-111vascular plant one zinc finger protein