PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 532aa    MW: 58680.1 Da    PI: 4.2092
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017458genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.2e-51111372128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   pGfrFhPtdeel+ +yLk+kv++k+l++ + i+ vd+y++ePwdLp  +k+k+++ ewyfFs  d+ky +g+++nrat++gyWk+tgkd+++ s ++
  Lus10017458  11 GPGFRFHPTDEELLRYYLKRKVTNKPLRF-DPISVVDVYRSEPWDLPvrAKLKSRDLEWYFFSLLDRKYGNGSKTNRATEKGYWKTTGKDRPIRS-NS 106
                  59*************************99.99***************5337777778**************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kktLv++ grap+ge+++Wvmheyrl
  Lus10017458 107 ATVGMKKTLVYHLGRAPRGERSNWVMHEYRL 137
                  9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-548142IPR003441NAC domain
PROSITE profilePS5100550.76210168IPR003441NAC domain
PfamPF023651.4E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MARGDSEAFL GPGFRFHPTD EELLRYYLKR KVTNKPLRFD PISVVDVYRS EPWDLPVRAK  60
LKSRDLEWYF FSLLDRKYGN GSKTNRATEK GYWKTTGKDR PIRSNSATVG MKKTLVYHLG  120
RAPRGERSNW VMHEYRLSEE ELEKFGVGQS GTGPKNGEQY GAPFVEEEWE DEDVPLLPGE  180
NAVVTDGLDE FYGEYLDAVD FDQKLEVGDE SAAAAVPITT YYEETSNYVE NGGSSSEDGS  240
NPLIDGALVT AAVPVDQQLP YAQHEEVDNN CEDVNYVGSS TKDLSIPKYE EMVDSSFVDA  300
GGSSQFADGL SFEAFELQDN MEPGSCSEDP TDFNLEEYLD FDDLSFDPFG PLENDASSYD  360
LSPESNKDLN GGVVNADINS ENLPSMNGHA SSSEQNTDAM MPKFNPMKSD FGTSYPFIGK  420
ASKMLGDIPA PPAYAAEFPV KGAALHFTSA QEASSSIRVT AGMIRIEEMG VRGNEMMFGK  480
NMGVNVVMSI TWPQGESSKT GSMSRVSLFL MLFWILVLSV SYKVGTCICA K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4441379140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10017458
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8852933e-69HQ885293.1 Linum usitatissimum clone Contig1165 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021624571.11e-177NAC domain-containing protein 78
TrEMBLA0A0M5JDB41e-175A0A0M5JDB4_MANES; NAC transcription factors 5
STRINGLus100174580.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-124NAC domain containing protein 2