PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 167aa    MW: 18235.7 Da    PI: 6.333
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017431genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.83.9e-4391081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp e+r da+sslvyeA ar+rdP+yG+vg i+ lq+q++ql+ +lal++
  Lus10017431   9 PCASCKLLRRRCTKDCIFAPYFPSHDPHKFAIVHKVFGASNVSKILQDLPMERRADAVSSLVYEAGARVRDPIYGCVGAISYLQSQVSQLQMQLALAQ 106
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Lus10017431 107 AE 108
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4268109IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-429106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MVTGASNSPC ASCKLLRRRC TKDCIFAPYF PSHDPHKFAI VHKVFGASNV SKILQDLPME  60
RRADAVSSLV YEAGARVRDP IYGCVGAISY LQSQVSQLQM QLALAQAEIL CIAGQQFKAA  120
PDYNLAMIHS DDDNYTTNSE SSLDDVVVAD GNKSLFLLQH GQYIDF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4365732e-46AM436573.2 Vitis vinifera contig VV79X000523.2, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604707.11e-69PREDICTED: LOB domain-containing protein 12-like isoform X2
RefseqXP_016435041.11e-69PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-65LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0L9U9N14e-69A0A0L9U9N1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S1095e-69A0A0S3S109_PHAAN; Uncharacterized protein
STRINGGSMUA_Achr6P15660_0014e-68(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-52LBD family protein