PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 324aa    MW: 35834.7 Da    PI: 4.9094
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016810genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.82.2e-26958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien +nrqvtfskRrng++KKA+EL +LCd+++a+i+fs++g+l  +s
  Lus10016810  9 KRIENITNRQVTFSKRRNGLIKKAYELAILCDIDIALIMFSPSGRLSHFS 58
                 79********************************************9997 PP

2K-box14.81.2e-0681154780
        K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 
                   + ++++ e lqqe+  L+++++  + ++  +  + L+  s+ +L++ e++L +s+++  ++K+ ll +++++ 
  Lus10016810  81 PESTNSNIEVLQQEVCSLQRQLQVAEDQLNMYEPNPLKFSSIGDLESCEKNLLDSMSRLEERKKYLLSNHVSTY 154
                  456789999****************999999999***********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.8E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.184161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-29280IPR002100Transcription factor, MADS-box
CDDcd002651.47E-35275No hitNo description
PRINTSPR004042.7E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRVKLQIKR IENITNRQVT FSKRRNGLIK KAYELAILCD IDIALIMFSP SGRLSHFSGK  60
RRIEDVIARY INLPDHDREC PESTNSNIEV LQQEVCSLQR QLQVAEDQLN MYEPNPLKFS  120
SIGDLESCEK NLLDSMSRLE ERKKYLLSNH VSTYGHSSMQ ILFDGQDGLP NFDSDIANWL  180
PDNGHNQNSV HVVSESSCIP VSNHSSATIF EALSQGNGNV DPCNNMGGGN HMNSSNGESI  240
SSWKQAFSSL SSTELLAAFL PPTSFAPIKQ QEVEGPSYTS MLQQQQQQQA ADAQSNCPQQ  300
QIQSTNGGDG SDYDQNLCPQ SST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-17192186Myocyte-specific enhancer factor 2B
1tqe_Q5e-17192186Myocyte-specific enhancer factor 2B
1tqe_R5e-17192186Myocyte-specific enhancer factor 2B
1tqe_S5e-17192186Myocyte-specific enhancer factor 2B
6c9l_A5e-17192186Myocyte-specific enhancer factor 2B
6c9l_B5e-17192186Myocyte-specific enhancer factor 2B
6c9l_C5e-17192186Myocyte-specific enhancer factor 2B
6c9l_D5e-17192186Myocyte-specific enhancer factor 2B
6c9l_E5e-17192186Myocyte-specific enhancer factor 2B
6c9l_F5e-17192186Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10016810
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580738.11e-143agamous-like MADS-box protein AGL104
TrEMBLA0A067LHN71e-137A0A067LHN7_JATCU; Uncharacterized protein
STRINGLus100168100.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85252735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-61AGAMOUS-like 104