PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016569
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family WOX
Protein Properties Length: 285aa    MW: 31466.9 Da    PI: 9.3306
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016569genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-192785457
                 -SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 R+t+t+ q++ Le l+++  r+p+ ++++++A+kl    +++ ++V++WFqN++a++++
  Lus10016569 27 RWTPTSPQINLLEGLYNQgLRTPTPDQIQQIAAKLsthgHIEGKNVFYWFQNHKARQRQ 85
                 *****************99**************************************96 PP

2Wus_type_Homeobox108.73.4e-352587365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       + RWtPt+ Qi++Le ly++GlrtP+ ++iq+i+a+L+++G+ie+kNVfyWFQN+kaR+rqkq
        Lus10016569 25 NFRWTPTSPQINLLEGLYNQGLRTPTPDQIQQIAAKLSTHGHIEGKNVFYWFQNHKARQRQKQ 87
                       67***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.4952186IPR001356Homeobox domain
SMARTSM003892.6E-62390IPR001356Homeobox domain
SuperFamilySSF466892.01E-122689IPR009057Homeodomain-like
CDDcd000861.13E-62787No hitNo description
PfamPF000462.8E-172785IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-72785IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDTSNNNTVP VKANKNTTTS RIPANFRWTP TSPQINLLEG LYNQGLRTPT PDQIQQIAAK  60
LSTHGHIEGK NVFYWFQNHK ARQRQKQKQD VINNHIHPNN HLPFVNPHHH FLRKPPLPPP  120
HSPHGAVRHV PSPSPGYCGT SSYSTSSQAD LGLPRQFRVV PAGGLTQLRP ADKILWRTAT  180
AAAHRIVPDT LNNNDGATNY HDCDNYQETL PLFPLHPTGG LLARSSTSSS SSDKLYDYNH  240
VSSSPSPSYS SCDTGVDVED GDSGRRCFDL FSIGKGHLCP SQRY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10016569
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100165690.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-29WUSCHEL related homeobox 2