PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 385aa    MW: 41481.2 Da    PI: 8.5057
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015764genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.81.7e-3972149178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +C v+gC +dl e+++yhrrhkvCe hsk++ v+v+g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Lus10015764  72 VCLVDGCISDLGECRDYHRRHKVCELHSKTARVFVKGREQRFCQQCSRFHSLGEFDEGKRSCRKRLDGHNRRRRKPQH 149
                  6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3265134IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.60770147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-3771149IPR004333Transcription factor, SBP-box
PfamPF031101.3E-2873146IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MFHGCNLKEH FGSAGIGEQG ISQLLVPRIA ETVNQSSNLC SVDLKLGMES SCSGPSKKAK  60
LPTSGSGQQV PVCLVDGCIS DLGECRDYHR RHKVCELHSK TARVFVKGRE QRFCQQCSRF  120
HSLGEFDEGK RSCRKRLDGH NRRRRKPQHP DPLSLSSARL FCDHQGTRYL QFGSSQVFAT  180
SAATSAWAET VKAENDSMLY SSSSNQSTLD FINNKRLVHP AALSQHNYRG KQFPFSQGTT  240
SSPVPGDSPG SCQQGFQVNP TLGSHGSSHK MFSSNGTNHV IDSDRALSLL SSLPPLCEAT  300
PEIGSSHVVH LPGPGAAQSS MPTNLRYLGM KTEPIGSVLV SNNSSHDVSS GLHHQNQGGL  360
FQIGPDDGSS GSGSRDHTLS FSFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2970146884squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129146KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10015764
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085714.11e-115squamosa promoter-binding-like protein 16 isoform X3
RefseqXP_020539135.11e-115squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_020539136.11e-115squamosa promoter-binding-like protein 16 isoform X1
RefseqXP_020539137.11e-115squamosa promoter-binding-like protein 16 isoform X1
TrEMBLA0A385JHL31e-109A0A385JHL3_POPTO; Squamosa promoter-binding protein-like
TrEMBLB9GMM71e-109B9GMM7_POPTR; Uncharacterized protein
STRINGLus100157640.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-44SBP family protein