PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 345aa    MW: 38937.1 Da    PI: 8.3562
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015367genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52111381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  + pGfrFhPtdeelv +yL++k+++++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ ++
  Lus10015367  11 MLPGFRFHPTDEELVGFYLRRKIQHRTLSI-ELIKQVDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGS 107
                  579***************************.89***************8888999***************************************9566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +glkk+Lvfy+gra kg ktdW+mhe+rl
  Lus10015367 108 KCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 138
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-579176IPR003441NAC domain
PROSITE profilePS5100556.03811176IPR003441NAC domain
PfamPF023652.2E-2513138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEEKGEVEEE MLPGFRFHPT DEELVGFYLR RKIQHRTLSI ELIKQVDIYK YDPWDLPKLA  60
TTGEKEWYFY CPRDRKYRNS ARPNRVTGAG FWKATGTDRP IYSSEGSKCI GLKKSLVFYR  120
GRAAKGIKTD WMMHEFRLPP LPDRSPSPPH PPPKKLLLDK TLPPNETWAI CRIFKKTNSM  180
AQRALSHPWM SSPMLPPADN SSHIFNHNPS QLGSSLVFQQ QPMFPFPACA TNNNFIFPPI  240
GSSIPPKTTL ISDPTTSESL EFSGFSIRNL QHSLESSADQ GDDLRKNNNI NQWDGIGNGN  300
GMRSSSIGFP FSLPTDDDVW DTVVHPAGDM SSNAACYSTN KCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-521317919168NO APICAL MERISTEM PROTEIN
1ut4_B3e-521317919168NO APICAL MERISTEM PROTEIN
1ut7_A3e-521317919168NO APICAL MERISTEM PROTEIN
1ut7_B3e-521317919168NO APICAL MERISTEM PROTEIN
4dul_A3e-521317919168NAC domain-containing protein 19
4dul_B3e-521317919168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10015367
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021818943.11e-127protein FEZ-like
SwissprotQ9ZVH08e-98FEZ_ARATH; Protein FEZ
TrEMBLA0A251Q9C61e-123A0A251Q9C6_PRUPE; Uncharacterized protein
TrEMBLA0A2P6S4M61e-123A0A2P6S4M6_ROSCH; Putative transcription factor NAM family
STRINGLus100153670.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-94NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]