PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 391aa    MW: 44274.5 Da    PI: 6.7369
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014095genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.97.2e-151151343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i+ ++ r  t+ kR++ +lKK +E SvLCd+++++iif+++
  Lus10014095 11 IKKERSRMQTYKKRKANLLKKINEFSVLCDVKACLIIFGPN 51
                 88899999*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.357151IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-12166IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-18299IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-7323IPR002100Transcription factor, MADS-box
CDDcd002665.34E-18492No hitNo description
PfamPF003194.5E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGHKRVKMEL IKKERSRMQT YKKRKANLLK KINEFSVLCD VKACLIIFGP NTNNVSNQLE  60
LETWAPESCS IQDLIQQYRT SDQPRRCYSV SDYFSEKKKR VDVEIAKLRK QIHKQQFPTE  120
DGDRFNRFSA DELKLILGSI DSKLEAADQR IAALNAKRNL GIVHHQAVPI STWPQNNNPV  180
ESGFGIEREF DDDDDVAVHH QDLSRHCQFE QQNSVNALLQ LNSNHNNNYF DNYYYQNNNN  240
SLGFPAEEQN FFPEVPFCFQ PAELTGPLMA EFGSPDKGFN FGLMQAQRYP NFLMQQEMTI  300
NNQVVGRSNG MIHHGLLNSL PGTSTGATSS RPWNFDSAGN PDAGMSFIAS SSYKQQFQFS  360
PMAAGFANPR MFDESIGGGF EFGGGDHKQL *
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10014095
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100140950.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-20M-type_MADS family protein