PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 146aa    MW: 16058.9 Da    PI: 8.6131
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013999genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.7e-4165141278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  Cq+e+C++d++ a++y++rhkvCevh++apvvlv+g++qrfCqqCsrfhelsefD++k+sCrrrLa+hnerrrk+++
  Lus10013999  65 CQAENCSSDMAGARRYYKRHKVCEVHARAPVVLVAGVHQRFCQQCSRFHELSEFDDTKKSCRRRLAGHNERRRKSSS 141
                  **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-3258126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.00962139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.52E-3863141IPR004333Transcription factor, SBP-box
PfamPF031109.8E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MARVEGGKRT LKEIEEDDED QDELLDEALG FDVDKKTKKG KRVVVGSTSS WSSSGGGGGV  60
AAVSCQAENC SSDMAGARRY YKRHKVCEVH ARAPVVLVAG VHQRFCQQCS RFHELSEFDD  120
TKKSCRRRLA GHNERRRKSS SEGPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3455138184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10013999
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021599419.14e-47squamosa promoter-binding protein 1-like
SwissprotQ387409e-41SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A1R3H4E42e-47A0A1R3H4E4_9ROSI; Squamosa promoter-binding-like protein
STRINGLus100139991e-102(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.14e-39squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]